KEGG   Xanthomonas gardneri: BI317_03160Help
Entry
BI317_03160       CDS       T04668                                 

Definition
(GenBank) beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
xga  Xanthomonas gardneri
Pathway
xga00460  Cyanoamino acid metabolism
xga00500  Starch and sucrose metabolism
xga01100  Metabolic pathways
xga01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BI317_03160
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    BI317_03160
Enzymes [BR:xga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     BI317_03160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like PKD
Motif
Other DBs
NCBI-ProteinID: APP83321
UniProt: A0A1L5XYL0
Position
721975..724146
Genome map
AA seq 723 aa AA seqDB search
MAADRIETLIAQMTVEEKVGQLGVFADMVRPFAPDVNPEANVLNADEVLQQVRQGRVGSL
FNGVGAALGVQIQKVAVEESRLGIPVILAADVIHGMRTVFPIPLGEAASFEPELAERTAR
ATAIEATAAGLHWTYAPAVDIARDQRWGRGAEGAGEDVLLGAVFAAARVRGFQGSDLKAA
DSLLATPKHFAAYGAVAAGMEYNTVDIAPQTLRDVHLPPFKAAFDAGALTVMSSFNDING
VPASANHELLTEILRGEWQFPGVVISDYTADMELIAHGYATDERDATKKAFLAGLDLSMQ
SGFYAAHLPSLVESGEVPMSTLDASVRRMLQLKEAIGLFDNPYRSLDPAREADTAHLPAH
DALSRDAARRSIVLLKNEGAVLPLKKSGQHIALIGPFVQDRENIEGCWTLFGDKERYVTL
EQGVRAVVGNEHLSVVPGCGLEEALPGGISAAIDAAQAADVVVLALGEPQRFSGEAQSRT
EIVLPPAQQALAEAIAATGTPMVVLLRNGRALALSGAVRDADAIAVTWYLGTQTGTGVAD
VLFGDYNPSARLPISFPQVTGQQPYFYNHLRTGRPELPTLSEYKARWREMPNEPLYPFGH
GLSYTTFAYAPPQLSSAQVGWDQALTITTRVTNTGSVAGEEVVQLYVHDRVASRVRPVRE
LKGFRKVLLQPGESTDVVFTLARDALAFTDPKGVFGAEPGLFDVWVCASAKSGEAVSFEL
LEG
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgatcgcatcgaaaccctgattgcccagatgaccgtcgaagagaaggtcgga
cagttgggtgtgttcgccgacatggtgcggccgttcgcgccggacgtgaatcccgaagcc
aatgtgctcaacgccgacgaggtgctgcagcaggtccggcagggccgggtcggctcgctg
ttcaatggcgttggcgccgcgcttggcgtacagatccagaaagtggcggtggaagaaagc
cgtctgggcatcccggtgatcctggccgccgacgtgatccacggcatgcgcacggtgttc
ccgattccgctgggcgaagcggccagcttcgagccggaactggccgagcgcaccgcgcgc
gccaccgcgatcgaagcgaccgccgctggcctgcactggacctatgctccggcggtggac
attgcgcgcgatcagcgctggggccgtggggcagaaggcgccggcgaagacgtgctgctg
ggcgctgtgtttgctgccgcccgcgtgcgcggtttccagggtagcgatctcaaagccgcc
gattcgctgttggccacgcccaagcactttgccgcctatggcgcggtggcggcgggcatg
gaatacaacaccgtggacatcgcgccgcaaaccttgcgcgatgtgcatctgccgccgttc
aaggctgccttcgatgccggcgcattgaccgtgatgtcctcgttcaacgacatcaacggc
gtgccggccagcgccaaccacgagttgctgaccgagatcctgcgtggcgaatggcagttc
cccggcgtggtgatttccgactacaccgccgacatggaattgatcgcgcacggttacgcc
accgatgagcgcgatgcgaccaaaaaagcgttcctggccggtctggatctgagcatgcag
agcggtttctatgccgcgcatctgccgtcgctggtggaaagcggcgaggtgccgatgtcc
acgctggatgcgagtgtgcgccgcatgctgcagctgaaagaagcaatcggcttgttcgac
aatccgtatcgctcgctggatccggcacgcgaagccgacaccgcgcatctgccggcgcac
gatgcgttgtcacgcgatgcggcgcggcgttcgatcgtgttgctgaagaacgaaggcgca
gtgttgccgctgaagaaaagcggacagcacatcgcgctgatcgggccgttcgtgcaggac
cgcgagaacatcgagggctgctggaccttgttcggcgacaaggaacgctacgtgaccctg
gagcagggcgtgcgtgcggtggtcgggaacgagcatctgagcgtggtgccgggctgcggc
ctggaagaggcgctgccaggcgggatttccgccgccatcgatgcggcgcaggccgccgat
gtggtggtgctggcgctgggcgagccgcagcggttcagtggcgaggcgcagtcgcgtacc
gagatcgtattgccaccggcgcagcaggcgctggccgaagccatcgccgccaccggcaca
ccgatggtggtgttgctgcgcaacgggcgtgcgctggcattgagcggtgcggtgcgcgat
gctgatgcgattgcagtgacctggtatctgggcacgcagaccggcaccggcgtggccgat
gtgttgttcggcgactacaacccgtctgcgcggctgccgatcagcttcccgcaggtgacc
gggcagcagccgtatttctacaaccatctgcgtaccggccgcccggagttgccgaccttg
tccgaatacaaggcgcgctggcgcgaaatgcccaacgagccgttgtatccgttcggccac
ggcttgagctacaccacgtttgcgtatgcgccgccgcagctgagcagcgcgcaggttggt
tgggatcaggcgctgaccatcaccacgcgcgtgaccaataccggcagcgttgcaggcgaa
gaagtggtgcagctgtatgtgcacgatcgcgtggccagccgggtgcgcccggtgcgcgaa
ctcaagggctttcgcaaggtgttgttgcagcctggcgaaagcacggacgtggtgtttacc
ctcgcgcgcgatgcgctggccttcaccgaccccaagggcgtattcggcgcagagccggga
ttgttcgatgtgtgggtctgcgcatccgccaagagcggcgaggcagtgtccttcgagttg
ttggaaggctga

DBGET integrated database retrieval system