KEGG   Xanthomonas gardneri: BI317_04035Help
Entry
BI317_04035       CDS       T04668                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
xga  Xanthomonas gardneri
Pathway
xga00350  Tyrosine metabolism
xga00643  Styrene degradation
xga01100  Metabolic pathways
xga01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BI317_04035
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    BI317_04035
Enzymes [BR:xga01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     BI317_04035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: APP83471
UniProt: A0A1L5XYZ6
Position
903877..904539
Genome map
AA seq 220 aa AA seqDB search
MSAPLELFSYWRSSAAYRVRIGLQLKALAYIAHPVHLVRDGGEQHAPAYAQLNPQELVPT
LRHGAVVIPQSLAILEYLEEAFPDSARLLPAAPAERARVRALAQVIACDVHPLNNLRVAQ
FFEREWQLAAAQRQEWTQHWMQRGFAALEAQLGNDLQTGAFCHGDTPGLADCVLIPQLYN
ARRFAVDLTPYPTLQRIEQACLALPAFDAARPEVQPDASV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaccactggaattgttttcgtactggcgctccagcgcggcgtatcgcgtgcgc
attggcctgcagttgaaggcgctggcctacatcgcgcatccggtgcacctggtgcgcgat
ggcggcgagcagcacgcgccggcgtatgcgcagctcaatccgcaggaactggtgcccacg
ttgcggcatggcgcggtggtgattccgcagtcgctggcgatcctggaatatctggaggag
gcgttcccggacagtgcgcggttgctacccgccgcgccggccgagcgcgcccgcgtgcgt
gcattggcgcaggtcatcgcctgcgatgtgcatccgctcaacaatctgcgcgtcgcccag
tttttcgaacgcgaatggcaactggctgccgcacaacgccaggagtggacgcagcactgg
atgcaacgcgggtttgcggcattggaagcgcagttgggcaatgacctgcaaaccggcgcg
ttctgccacggcgacacgccgggtctggccgattgcgtgctgattccgcagctctacaac
gcgcgccgtttcgccgtcgatctgacgccgtatccaaccctgcaacgcatcgaacaggcg
tgcctggcactgccggcgttcgatgcggcgcggccggaagtgcagcctgacgcgtcagtg
tag

DBGET integrated database retrieval system