KEGG   Xanthomonas gardneri: BI317_04175Help
Entry
BI317_04175       CDS       T04668                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
xga  Xanthomonas gardneri
Pathway
xga00051  Fructose and mannose metabolism
xga00520  Amino sugar and nucleotide sugar metabolism
xga01100  Metabolic pathways
xga01110  Biosynthesis of secondary metabolites
xga01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BI317_04175
   00520 Amino sugar and nucleotide sugar metabolism
    BI317_04175
Enzymes [BR:xga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BI317_04175
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     BI317_04175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 DUF218 SRP54
Motif
Other DBs
NCBI-ProteinID: APP83497
UniProt: A0A1L5XZ17
Position
complement(934308..935711)
Genome map
AA seq 467 aa AA seqDB search
MSDVLPIILSGGSGTRLWPLSRESYPKQFLPLVGEHSMLQATWLRSAPVAAHAPIVVANE
EHRFMAAEQLQQLGVKPSAILLEPKGRNTAPAIAVAALEATRNGGDPLLLVLPSDHVIRD
EAAFQAAVTVAAAAAEQGKLVTFGIKPTAPETGYGYIKAGAGTGATAVERFVEKPDLVTA
QGYLASGEYYWNSGMFLFRASRYLEELRKFHPAIADACQKAWEGGKRDADFTRLDKDAFA
SSPSDSIDYAVMEKTADAVVVPLDAGWNDVGSWSSLLDVSEQDGQGNAHHGDVIQLDCKN
TYAYGSRLIAMVGLEDVVVVETPDAVLVGHRDRIQEVKDVVGRIKADGRSEATWHRKVYR
PWGAYDSIDMGHRHQVKRITVKPGAVLSLQMHHHRAEHWIVVSGTAEVTRGEEVLLLTEN
QSTYIPLGVTHRLRNPGKLPLELIEVQSGSYLGEDDIVRFEDTYGRT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgtccttccgattatcctgtccggcggttccggcacgcgcctttggccgttg
tcgcgcgaatcgtacccgaagcagttcctgccgctggtcggcgagcacagcatgctgcag
gccacctggctgcgttcggctccggtggccgcgcacgcgcccatcgtggtggccaacgaa
gaacaccgcttcatggcggccgagcagctgcagcagctgggcgtgaaaccttcggccatt
ttgcttgagcccaagggccgcaacactgccccggcaattgccgtcgctgcattggaagcc
acccgtaacggtggcgatccgctgttgctggtgcttccttccgatcatgtcattcgtgac
gaggccgccttccaggctgccgtgaccgtcgcggcagctgccgcagaacagggcaagctg
gtcaccttcggcatcaagccgactgcgcctgaaaccggctatggctacatcaaggccggc
gccggcaccggcgccactgcggtcgagcgcttcgtagaaaaacccgacctggtcaccgcg
cagggctacctggccagcggcgagtattactggaacagcggcatgttcctgttccgtgcc
tcgcgctatctggaagaactgcgcaaattccatcccgccatcgccgacgcgtgtcagaag
gcgtgggaaggcggcaagcgcgatgccgacttcacccgtctggacaaggatgcgttcgcc
tccagcccgtcggattcgatcgactatgcggtgatggaaaagactgccgatgcggtcgtc
gtgccgctggatgccggctggaatgacgttggctcatggtcctcgctactggacgtctcc
gagcaggatggccaaggcaatgcgcatcatggcgatgtcatccagctcgattgcaagaac
acctatgcgtatggctcgcgcctgattgccatggtcggtctggaggacgtggttgtggtg
gagacgccagacgccgttctggtcggtcaccgcgatcgcatacaggaagtgaaggatgtg
gtcggccggatcaaggccgacggtcgctccgaggcgacctggcatcgcaaggtctatcgt
ccgtggggtgcttacgattcgatcgacatgggccaccgtcaccaggtcaagcgcatcacc
gtcaagcccggtgccgtgctcagtctgcagatgcatcaccaccgcgccgagcactggatc
gtcgtcagcggcaccgcagaagtcacgcgtggcgaagaggtgctgctgctcaccgagaac
cagagtacttatattccgcttggcgtgacccatcgcctgcgcaatccaggcaaattgccg
ctggaactgatcgaagtgcagtccggcagctatctgggcgaagacgacatcgtgcgtttc
gaagatacctacgggcgcacctga

DBGET integrated database retrieval system