KEGG   Xanthomonas gardneri: BI317_05680Help
Entry
BI317_05680       CDS       T04668                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
xga  Xanthomonas gardneri
Pathway
xga03010  Ribosome
Brite
KEGG Orthology (KO) [BR:xga00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BI317_05680
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:xga03011]
    BI317_05680
Ribosome [BR:xga03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BI317_05680
  Bacteria
    BI317_05680
  Archaea
    BI317_05680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: APP83752
UniProt: A0A0G8M7R1
Position
1255115..1255456
Genome map
AA seq 113 aa AA seqDB search
MTMEAKAILRTARISPQKARLVADQVRGLSAERAVNLLKFSDKKAAHLIKKVVESAIANA
ENNQGADVDELKVKTIMVDEGPSLKRFMARAKGRGTRILKRTSHITVIVGAAK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggaagcgaaagcaatcctgcgcaccgcgcgcatctccccgcagaaggcccgc
ctggtcgctgaccaggtgcgtggactgtccgccgaacgtgcggtcaatctgctgaagttc
tcggacaagaaggctgcacacctgatcaaaaaggtagtggagtcggctattgccaatgcc
gagaacaatcagggcgcggatgtcgacgagctgaaggtcaagaccatcatggttgatgaa
ggtccctccctgaagcgtttcatggcgcgggcgaaaggccgcggtacccgcatcctcaag
cgcaccagtcacatcactgtgattgttggcgccgccaagtaa

DBGET integrated database retrieval system