KEGG   Xanthomonas gardneri: BI317_09000Help
Entry
BI317_09000       CDS       T04668                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
xga  Xanthomonas gardneri
Pathway
xga00564  Glycerophospholipid metabolism
xga01100  Metabolic pathways
xga01110  Biosynthesis of secondary metabolites
Module
xga_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:xga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BI317_09000
Enzymes [BR:xga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BI317_09000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: APP84292
UniProt: A0A1L5Y1B8
Position
complement(1963940..1964788)
Genome map
AA seq 282 aa AA seqDB search
MSLVTSLTYVLPHRLLSSMARALAYSDTPSTKQWLIDTVTRKFGVDLSEALEPDPRAYPT
FNAFFTRALKPGARVPDADPAAVLMPADGRISQLGPIENGRIFQAKGQSFTAAELLGDAE
AAQPFNDGLFATVYLSPKDYHRVHMPWTGTLRETVHVPGRLFSVGPDAVRNVPRLFARNE
RLVCHFDTDFGPMASVMVGALLVSGVETVWSGVEIPRYGDRITRKDYRGKGIVLERFAEM
ARFNYGSTVIVLLPPGVAKLEAGLAAETSVRLGQALAHRQLS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctcgtcacttccctgacctacgtgctgccgcatcggttgctgtcctcgatggca
cgcgcgctggcttattcggatacgccgtccaccaagcaatggttgatcgacacggtgacg
cgcaagttcggcgtggacctgagcgaggcattggagccggatccgcgcgcgtaccccacc
ttcaatgcgttcttcacccgtgccttgaagccgggcgcacgcgtgcccgacgccgacccc
gcagccgtgctgatgccggccgatggccgtatcagccagctcggtccgatcgagaacggc
cgtatcttccaggccaaggggcagtcgtttaccgctgccgaactgctcggcgatgccgaa
gccgcgcagccgttcaacgatgggttgttcgccaccgtctatctctcgcccaaggactac
caccgggtgcatatgccctggaccggcaccttgcgcgagaccgtgcatgtgcccggccgc
ttgttcagcgtgggcccggatgcagtacgtaacgtgccgcgcctgttcgcccgcaacgag
cgcctggtgtgccacttcgataccgacttcggcccgatggcctcggtgatggtgggcgcg
ctattggtgtccggcgtggagacggtgtggagcggcgtggagatcccgcgctatggcgat
cgcatcacgcgtaaggattatcgcggcaagggcattgtgctggagcggtttgcggagatg
gcgcgcttcaactacggatctaccgtgatcgtgttgctgccaccaggtgtcgcgaagctc
gaagctggacttgctgcggagacatcggtgcgtctggggcaagcgctcgcacatcgccag
ctgagctga

DBGET integrated database retrieval system