KEGG   Xanthomonas gardneri: BI317_18805Help
Entry
BI317_18805       CDS       T04668                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
xga  Xanthomonas gardneri
Pathway
xga00010  Glycolysis / Gluconeogenesis
xga00030  Pentose phosphate pathway
xga00051  Fructose and mannose metabolism
xga00680  Methane metabolism
xga01100  Metabolic pathways
xga01110  Biosynthesis of secondary metabolites
xga01120  Microbial metabolism in diverse environments
xga01130  Biosynthesis of antibiotics
xga01200  Carbon metabolism
xga01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BI317_18805
   00030 Pentose phosphate pathway
    BI317_18805
   00051 Fructose and mannose metabolism
    BI317_18805
  09102 Energy metabolism
   00680 Methane metabolism
    BI317_18805
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xga04131]
    BI317_18805
   03036 Chromosome and associated proteins [BR:xga03036]
    BI317_18805
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xga04147]
    BI317_18805
Enzymes [BR:xga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BI317_18805
Membrane trafficking [BR:xga04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BI317_18805
Chromosome and associated proteins [BR:xga03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    BI317_18805
Exosome [BR:xga04147]
 Exosomal proteins
  Proteins found in most exosomes
   BI317_18805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-ProteinID: APP85903
UniProt: A0A0G8LAB3
Position
complement(4103954..4104958)
Genome map
AA seq 334 aa AA seqDB search
MSIEQLAETAQAMVAPGKGIIAIDESTSTIAKRFASVGIENIEENRRAYRELLLTTPKLS
DYISGAILFDETIRQKTKDGVPFAEYMTAHGIIPGIKVDKGAQPLAGMPGELVTEGLDGL
RARLEEYYTLGARFAKWRAVINIGEDIPSGTCIEANSHALARYAALCQEQGLVPMVEPEV
IMDGSHDIETCYEVTEATLRSLFGALYEQNVVLEGTILKASMVISGKGCEEQAGIEEVAE
STVMCLKSTVPAILPGIVFLSGGQSDEQSTAHLNEMHQLGNLPWPLSFSYGRAMQQAALK
LWAKDMTGNFAKAQQIIYERAKENGLAALGKWKG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaacagcttgccgaaaccgcccaggccatggtcgccccgggcaagggcatc
atcgccatcgacgaatcgaccagcacgatcgccaagcgttttgccagcgtcggcatcgag
aacatcgaagaaaaccgtcgcgcatatcgcgaactgctgctgaccacgcccaagctgagc
gattacatctccggcgccatcctgttcgacgagaccatccgtcagaagaccaaggacggc
gtgccgttcgccgagtacatgaccgcccacggcatcattccgggcatcaaggtcgacaag
ggtgcgcagccgctggccggcatgccgggcgagctggtcaccgaaggtctggacgggctg
cgcgcacgtctggaggagtactacacgctgggcgcgcgtttcgccaagtggcgtgcggtc
atcaacatcggcgaagacatcccgtccggcacctgcatcgaggccaattcgcatgcgctg
gcgcgttacgccgcgctgtgccaggaacagggcctggtgccgatggtcgagccggaagtg
atcatggacggcagccacgacatcgagacctgctacgaagtcaccgaagcgacgctgcgt
tcgctgttcggcgcactgtatgagcagaatgtcgtgctcgaaggcaccatcctgaaggcc
tcgatggtcatctccggcaagggctgcgaagagcaggccggcatcgaagaagtggccgag
tccaccgtgatgtgcctgaagtcgaccgtgccggcgatcctgccgggcatcgtgttcctg
tccggcggccagagcgacgagcagtccaccgcgcacctcaacgagatgcaccagctcggc
aatctgccgtggccgctgagcttctcctacggccgtgcgatgcagcaggccgcactgaag
ctgtgggccaaggacatgaccggcaacttcgccaaggcgcagcagatcatctatgagcgc
gccaaggaaaacggtctggccgcgctgggcaagtggaagggttga

DBGET integrated database retrieval system