KEGG   Xanthomonas gardneri: BI317_19185Help
Entry
BI317_19185       CDS       T04668                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
xga  Xanthomonas gardneri
Pathway
xga00860  Porphyrin and chlorophyll metabolism
xga01100  Metabolic pathways
xga01110  Biosynthesis of secondary metabolites
xga01120  Microbial metabolism in diverse environments
Module
xga_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BI317_19185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xga01007]
    BI317_19185
Enzymes [BR:xga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BI317_19185
Amino acid related enzymes [BR:xga01007]
 Aminotransferase (transaminase)
  Class III
   BI317_19185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: APP85967
UniProt: A0A1L5Y631
Position
4187562..4188851
Genome map
AA seq 429 aa AA seqDB search
MNHSRSHALFAQAQTLLPGGVNSPVRAFKSVGGEPFFVARADGPYLYDVDDNRYIDYVGS
WGPMIAGHNHPAVREAVERAIRDGLSFGAPCAAEVTMAETINRLVPSCEMVRMVNSGTEA
TLSAVRLARGATGRNRIVKFEGCYHGHGDSFLVKAGSGMLTLGVPTSPGVPPGLSELTAT
LTFNDFEGATALFDDIGADVAAVIIEPVVGNANCIPPQAGYLQHLRTLCTRHGALLIFDE
VMTGFRVALGGAQAHYGVTPDLSTFGKIIGGGMPVGAYGGRRDLMEQIAPSGPIYQAGTL
SGNPVAMAAGLAMLELVQEPGFHARLSAQTSALCEGLEDAAHAAGIAVTTNQVGGMFGLF
FTDEIVESYAQATACDITTFNRFFHAMLQRGVYLAPSAYEAGFMSSAHDAAVIEATLAAA
REAFAEVAR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaccactcccgctcccacgccctgttcgcccaggcgcagaccctgctgcccggcggc
gtcaactccccggtgcgggcgttcaagtcggtgggcggcgagccgttcttcgtggcgcgc
gccgatggcccgtatctgtatgacgtggacgacaaccgctacatcgactacgtgggctcg
tgggggccgatgatcgccggccacaatcacccggcggtgcgcgaggcggtggagcgtgcg
atccgcgatgggctgtcgttcggtgcgccgtgtgcggccgaagtgaccatggccgagacg
atcaatcggctggtgccctcctgcgaaatggtgcgcatggtcaattccggcaccgaagcc
acgctgtcggcggtgcgcctggcgcgcggcgccaccgggcgcaatcgcatcgtcaagttc
gaaggctgttaccacggccatggcgactcgtttctggtcaaggccggcagcggcatgctc
acgctgggcgtgccgacctcgcccggcgtgcctcctggcctgagcgagctgaccgccacc
ctcaccttcaacgacttcgaaggcgccacggcgctgttcgacgacatcggcgccgatgtg
gcggcggtgatcatcgaaccggtggtgggcaacgccaactgcattccgccgcaggccggc
tacctgcagcacctgcgcacgctgtgcacgcggcacggcgcgctgctgatcttcgacgaa
gtgatgaccgggttccgcgtggcgctcggtggcgcgcaggcgcattacggggtgaccccg
gacctgagcaccttcggcaagatcattggcggcggcatgccggtgggcgcgtacggcggc
cggcgcgacttgatggagcagatcgcaccttccggcccgatctaccaggccggcaccttg
tcgggcaatccggtggcgatggcggcgggcctggcgatgctggagctggtgcaggagccg
ggcttccacgcacgcctgagcgcgcagaccagcgcgctgtgcgaaggcctggaagatgcc
gcccacgcggccggcatcgcggtcaccaccaatcaggtcggcggcatgttcgggctgttc
ttcaccgacgagatcgtggagagctacgcgcaagccaccgcctgcgatatcaccaccttc
aaccgtttcttccacgcgatgctgcagcggggcgtgtatctggcgccatcggcgtacgaa
gccggcttcatgtccagcgcgcacgacgctgcggtgatcgaagccacgcttgcagcggca
cgcgaggcatttgcggaagtggcgcgctga

DBGET integrated database retrieval system