KEGG   Xanthomonas gardneri: BI317_23500Help
Entry
BI317_23500       CDS       T04668                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
xga  Xanthomonas gardneri
Pathway
xga00620  Pyruvate metabolism
xga00630  Glyoxylate and dicarboxylate metabolism
xga01100  Metabolic pathways
xga01110  Biosynthesis of secondary metabolites
xga01120  Microbial metabolism in diverse environments
xga01200  Carbon metabolism
Module
xga_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BI317_23500
   00630 Glyoxylate and dicarboxylate metabolism
    BI317_23500
Enzymes [BR:xga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BI317_23500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: APP86654
UniProt: A0A1L5Y825
Position
complement(5155718..5157334)
Genome map
AA seq 538 aa AA seqDB search
MSATAFAPRSTERATPGLSLTTQVAGQAELLPAAALALLVSLHRAIEPGRQQRLAQRRVR
QAEFDAGQLPDFRSDTRAIRAGDWRVAALPAALQDRRVEITGPTDPKMVINALNSGAKVF
MADFEDSTAPTWRNLLAGQRTLAAAVRGDLSFDAPNGKHYALRPEAERAVLIVRPRGWHL
DEKHVLIDGQPLAGGLFDAAVFAFHNGRALLAKDRGPYLYLPKLQSMEEAALWETALAHI
EAMLGLPHGQIKVTVLIETLPAVFEMDEILHALRDRIVGLNCGRWDYIFSYLKTFRAHRD
RVLPERGQVTMTQPFLKAYSELLIKTCHRRGAHAMGGMAAQIPINHDEAANEQAMARVRA
DKLREVTAGHDGTWVAHPALIPVAMKLFDEHMPTAHQHHVLRNDVQVTRDMLIAPSPGNV
TRAGFEGNVEVCVRYLAAWLDGNGCVPIHNLMEDAATAEISRTQLWQWLHHGQHLDDGTA
IDQQLLQAALRALPARLGATNALPGAARIDDAIALLETLSRADELADFLTVPAYRLID
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaccgctttcgctccacgctctaccgaacgcgccactcccggtctgtcgctg
accacgcaggtggccggccaggcagaactcctgccagccgccgcgttggcgttgctggtg
tcgctgcaccgcgcgatcgaacccggtcgccagcagcgcctcgcccagcggcgggtgcgc
caggccgagttcgacgccggccagttgccggactttcgctctgacacccgcgccatccgc
gccggcgactggcgcgtggccgcgctgccggcggcgctgcaggaccgccgcgtcgagatc
accggccccaccgatccgaagatggtcatcaacgcgctgaattccggcgccaaggtgttc
atggccgacttcgaagattccaccgcgccgacctggcgcaacctgctggccggccagcgc
acgttggccgctgcggtgcgcggcgatctcagcttcgatgcgcccaacggcaagcactac
gcgctgcgcccggaagccgagcgcgcggtgttgatcgtgcgcccgcgcggctggcatctg
gacgagaagcacgtgctcatcgatggccagccgctggccggcggcttgttcgatgctgcg
gtgttcgccttccataacggccgtgcgctgctggccaaggaccgcggcccgtatctgtat
ctgcccaagctgcagagcatggaagaagccgcgctgtgggagaccgcgctggcgcatatc
gaagcgatgctcggcctgccgcatgggcagatcaaggtgaccgtgctgatcgaaacgctg
ccggcggtgttcgagatggacgagatcctgcacgcgctgcgcgatcgcatcgtcgggctc
aattgcgggcgctgggactacatcttttcgtacctgaaaacctttcgcgcgcaccgcgac
cgcgtactgcccgagcgtggtcaggtcaccatgacccagccgttcctgaaggcgtattcg
gagctgttgatcaagacctgtcatcgccgtggtgcgcatgccatgggcggcatggccgcg
cagattccgatcaatcacgacgaagccgccaacgagcaggcgatggcccgcgtgcgtgcc
gacaagttgcgcgaagtgacggccgggcacgatggcacctgggtagcgcatccggctttg
attccggtggcgatgaaattgttcgacgagcacatgcccaccgcgcatcagcatcacgtc
ttgcgcaacgatgtgcaggtgacgcgcgacatgttgatcgccccctcgccgggcaacgtc
acccgcgcagggttcgaaggcaatgtcgaagtgtgcgtgcgctacctggccgcctggctg
gacggcaatggctgcgtgccgatccacaacctcatggaagacgccgccactgcagaaatc
agccgcacgcagctatggcagtggctgcatcacggccagcatctggacgacggcactgcc
atcgatcagcagttattgcaggccgcgttgcgtgcgctgccggcacgcctgggcgcgacc
aacgcactgcctggcgctgcgcgcatcgacgacgccatcgccttgctggaaacactcagc
cgcgccgatgaactggccgacttcctcactgtgcctgcgtaccgattgatcgattga

DBGET integrated database retrieval system