KEGG   Xanthomonas gardneri: BI317_23720Help
Entry
BI317_23720       CDS       T04668                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xga  Xanthomonas gardneri
Pathway
xga00071  Fatty acid degradation
xga00072  Synthesis and degradation of ketone bodies
xga00280  Valine, leucine and isoleucine degradation
xga00310  Lysine degradation
xga00362  Benzoate degradation
xga00380  Tryptophan metabolism
xga00620  Pyruvate metabolism
xga00630  Glyoxylate and dicarboxylate metabolism
xga00640  Propanoate metabolism
xga00650  Butanoate metabolism
xga00900  Terpenoid backbone biosynthesis
xga01100  Metabolic pathways
xga01110  Biosynthesis of secondary metabolites
xga01120  Microbial metabolism in diverse environments
xga01130  Biosynthesis of antibiotics
xga01200  Carbon metabolism
xga01212  Fatty acid metabolism
xga02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BI317_23720
   00630 Glyoxylate and dicarboxylate metabolism
    BI317_23720
   00640 Propanoate metabolism
    BI317_23720
   00650 Butanoate metabolism
    BI317_23720
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BI317_23720
   00072 Synthesis and degradation of ketone bodies
    BI317_23720
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BI317_23720
   00310 Lysine degradation
    BI317_23720
   00380 Tryptophan metabolism
    BI317_23720
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BI317_23720
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BI317_23720
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BI317_23720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xga04147]
    BI317_23720
Enzymes [BR:xga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BI317_23720
Exosome [BR:xga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BI317_23720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APP86688
UniProt: A0A0G8KWA0
Position
complement(5203449..5204744)
Genome map
AA seq 431 aa AA seqDB search
MPGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSSDWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLLAANRAKATGDKLKALLRGFKFGELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNIARDSQDAWAVASHHKLAAAYERGFFDSLIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
AAVDFVHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcaaccgatgccagcagcccgtcccgtcgccatcttgggcggcgttcgtatc
ccgttctgtcgtcagaacaccgcatacgcggacgtgggcaacctgggcatgtcggtgcgc
acgctgggcgcgctggtcgagcgcttcgggctgcatgggcagcaactgggcgaagtggcg
atgggggcggtgatcaagcactcctcggactggaatctggcccgcgaggcggcgctgtcg
tccggcctgtcgccgctgacgccgggcatcaccctgcagcgcgcctgcggcaccagcctg
gattctgtgatcaccatcgccaacaagattgcgctgggccagatcgattcgggcatcggc
ggcggttcggacacgacgtccgaagtgccgatcgtctacggcaagaagctgcgcgcgcgg
ctgctggccgccaaccgggccaaagccaccggcgacaagctcaaggcgctgctgcgtggc
ttcaagtttggcgagctcaagcccgagttccccggcgtggccgagccgcgcaccggcaag
agcatgggcgaccactgcgaggacatggccaaggaatggaacatcgcgcgcgattcgcag
gacgcgtgggcggtggcctcgcatcacaagctggcggcagcgtatgagcgcggcttcttc
gattcgttgatcgccccgttccgcggtgtctcgcgcgacaatattttgcgtgccgacacc
tcgctggaaaaactcgccacgctgcgcccggccttcgacaagacttccggtcgcggcacg
ctgaccgcagccaattccaccccgctcaccgatggtgctgccgcggtgctgttgtccagc
gaagcctgggcgctggcgcacggccacaccccgatggcctatctgcgcgatgcacaggtg
gcggcggtggatttcgtgcatggcgaaggcctgctgatggcgccgaccattgcagtgccg
cagatgctggcgcgccagggcctgaccctgcaggacttcgacatctacgagatccacgag
gcgttcgccgcccaagtgttgtgcacgctgcgcgcctgggaaagcgaggactactgccgc
aatcgcctggggttggatgcgccgctgggccgcatcgacccggacaagatcaacccgctg
ggctcgtcgctggcgaccggccacccgttcgccgccaccggcgcgcgcgtggtggcaact
gctgccaagcagctggaagaacgtggcggcggccgtgcgttgatttcgatctgtacggcc
ggcggcatgggcgtggtcgccattgtcgagcgctga

DBGET integrated database retrieval system