KEGG   Xenorhabdus hominickii: A9255_04470Help
Entry
A9255_04470       CDS       T04538                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
xho  Xenorhabdus hominickii
Pathway
xho00030  Pentose phosphate pathway
xho00480  Glutathione metabolism
xho01100  Metabolic pathways
xho01110  Biosynthesis of secondary metabolites
xho01120  Microbial metabolism in diverse environments
xho01130  Biosynthesis of antibiotics
xho01200  Carbon metabolism
Module
xho_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
xho_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:xho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A9255_04470
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A9255_04470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xho04147]
    A9255_04470
Enzymes [BR:xho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     A9255_04470
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     A9255_04470
Exosome [BR:xho04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   A9255_04470
  Exosomal proteins of colorectal cancer cells
   A9255_04470
  Exosomal proteins of bladder cancer cells
   A9255_04470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AOM39891
UniProt: A0A2G0Q391
Position
944188..945663
Genome map
AA seq 491 aa AA seqDB search
MAVTSTAQACDLVIFGAKGDLARRKLMPSLYQLEKTGYIHPDTRIIGVGRADWDKKAYIK
VVEEALTTFLPEKLEPELWKKLSSRLEFCNLDVNKTDHFTKLAEVLNTSNLPAIHYFAMP
PSTFGAVCHGLGAAGLNKGPNRVVMEKPLGTDLASSRAINDEVAKYFNEKQIYRIDHYLG
KDTVLNLLALRFANSLFVNNWDHRTIDHVQITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILTMIAMSPPADLTADRIRDEKVKVLRSLRRIDNTNVREKTVRGQYTAGFVHGKKVPG
YLEEEGANKVSKTETFVSIRVDIDDWRWSGVPFYLRTGKRLPAKCSEVVVYFKEPPLNLF
AESYQQLPQNKLTIRLQPDEGIDIEVLNKAPGLEHKHRLQTTKLDLSFSETFNQTHLADA
YERLLLEAMRGIQALFVRRDEVEEAWKWVDSIIEAWAADNEPPKPYQSGTWGPVASIAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgacgtctacagctcaggcttgtgatttggtgatttttggggcgaaaggagac
ttagcacgccggaaattaatgccttccctttaccagttagaaaaaacgggttatatccac
ccagatacccgaattattggtgtcggtcgcgctgattgggataaaaaagcgtatatcaaa
gttgttgaagaagcgttgaccacatttttgcccgagaaattggagcctgaactgtggaaa
aaactcagttcacgtctggaattctgtaatttggatgttaataaaacggatcatttcacc
aaattggcagaggtactcaatacaagcaacttgccagcgattcattattttgccatgccg
ccaagtacattcggagcagtatgtcatggtttgggcgcagcggggctgaataagggacct
aatcgcgtcgtgatggaaaagcctctgggaacagatcttgcttcttccagagccattaac
gatgaagtagcaaaatatttcaatgaaaagcaaatttaccgtattgaccattatttgggc
aaagatacagtactgaacctactggcgttgcgttttgccaattcactgtttgttaataat
tgggatcatcgcacgattgatcatgtgcaaattaccgtagctgaagaagttggtatcgaa
gggcgttgggggtattttgatcaggctgggcagatgcgtgatatgatccagaaccatctt
ctgcaaatcctgactatgattgctatgtcaccacctgctgacctgacagccgatcgtatt
cgtgatgagaaagtgaaagtattgcgttcattgcgtcgaattgataacaccaatgtgcgg
gaaaaaaccgttcgcgggcaatataccgcaggttttgtgcatggtaagaaagttcctggt
tatctggaagaagagggtgcgaataaagtcagcaaaactgaaacttttgtttcgattcgt
gttgatattgatgattggcgctggtctggtgttcctttctacctgagaacagggaaacgt
ttaccggccaagtgttctgaagttgttgtctattttaaagaaccacccctgaatttgttt
gctgaatcctaccagcaattaccacagaataaattgacgatccgcttgcagccagatgaa
ggtattgatattgaagtactaaacaaggctccgggattggaacataaacaccgcttgcaa
acgaccaaactggatttgagtttctccgaaacctttaatcaaacgcatcttgcggatgct
tacgaaagattgctgttggaagctatgcgcggtattcaggcgctgtttgtccgtcgcgat
gaagtggaagaagcatggaagtgggtggattccataatagaagcatgggcagcggataat
gaaccaccaaaaccttatcaatcaggtacttgggggccggtggcgtccattgctatgatt
accagagatgggcgttcgtggaacgaatttgaataa

DBGET integrated database retrieval system