KEGG   Xanthomonas hortorum: XJ27_05255Help
Entry
XJ27_05255        CDS       T05082                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
xhr  Xanthomonas hortorum
Pathway
xhr00270  Cysteine and methionine metabolism
xhr00920  Sulfur metabolism
xhr01100  Metabolic pathways
xhr01110  Biosynthesis of secondary metabolites
xhr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    XJ27_05255
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    XJ27_05255
Enzymes [BR:xhr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     XJ27_05255
    2.3.1.46  homoserine O-succinyltransferase
     XJ27_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase
Motif
Other DBs
NCBI-ProteinID: ASW45447
UniProt: A0A248Y7J8
Position
1217668..1218870
Genome map
AA seq 400 aa AA seqDB search
MTEFIPPGTRFHALPSPFPMKRGGALHQAHVAYETWGTLTADRSNAVLIVTGLSPNAHAA
ANQASPEPGWWEAMLGPGKPIDTERWFVVCVNSLGSCKGSTGPASIDPATGALYRLTFPE
LSIEDVADAAADVVRALGIEQLACLIGNSMGGMTALALLLRHPGIARSHINISGSAQALP
FSIAIRSLQREAIRLDPHWNGGHYDDTRYPESGMRMARKLGVITYRSALEWDGRFGRVRL
DSEQAADDPFGLEFQVESYLEGHARRFVRFFDPNCYLYLSRSMDWFDLAEYVDDKPVIDA
GVDGQQVDNSHLAAKPDTGVSTDATVLAGLAQIRIARALAIGANTDILFPVQQQEQIAEG
LRAGGADAQFLGLDSPQGHDAFLVDFARFGPAVRDFLDAC
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattcattccccccggcacgcgcttccatgccctgccctcgccgtttccgatg
aagcgtggcggcgcgctgcaccaggcgcacgtcgcctacgaaacctggggcacgctgacc
gccgaccgcagcaatgcggtgttgatcgtcaccggactgtcgccgaacgcgcatgctgcg
gcaaatcaagccagccccgaaccgggttggtgggaagcgatgctggggccgggcaagccg
atcgataccgagcgctggttcgtggtgtgcgtcaattccctgggcagttgcaagggctcg
accggccccgcctcgatcgaccccgccaccggcgcgctgtatcgcctgacatttccggag
ttgtcgatcgaagatgtggccgatgcagcagccgatgtcgtgcgcgcgttgggcatcgaa
cagctcgcctgtctgatcggcaactcgatgggcggcatgaccgcgttggcgttgttgctg
cggcacccaggcattgcgcgcagccacatcaacatctccggcagcgcgcaggcgttgccg
ttctcgatcgccatccgctcgctgcagcgtgaagccatccgcctggatccgcactggaac
ggcggccactacgacgacacccgttatcccgaatcgggcatgcgcatggcgcgcaaactc
ggcgtgatcacctaccgctccgcgctggaatgggacggtaggtttggtcgcgtacgattg
gattccgagcaggccgccgacgacccgttcggtctggaattccaggtcgaaagttatctg
gaaggtcacgcgcgccgcttcgtgcgcttcttcgatcccaattgctatctgtatctgagc
cgctcgatggactggttcgatctggccgagtatgtcgacgacaagccggtcattgacgcc
ggagtcgatggccagcaagtcgataattcacacctcgccgccaagccagacacaggcgtc
tccaccgacgccacggtgctggccggtctggcgcagatccgcatcgcacgcgcactggca
atcggggccaataccgacatcctgtttcccgtacaacaacaggaacagatcgcagagggc
ctgcgcgccggtggtgcagatgcccagtttctcggactggattcgccacagggccacgat
gccttcctggtcgatttcgcgcgcttcggtccggccgtgcgcgactttctggacgcttgc
tga

DBGET integrated database retrieval system