KEGG   Xanthomonas hortorum: XJ27_07290Help
Entry
XJ27_07290        CDS       T05082                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
xhr  Xanthomonas hortorum
Pathway
xhr00564  Glycerophospholipid metabolism
xhr01100  Metabolic pathways
xhr01110  Biosynthesis of secondary metabolites
Module
xhr_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    XJ27_07290
Enzymes [BR:xhr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     XJ27_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ASW45791
UniProt: A0A248Y8B9
Position
1684926..1685774
Genome map
AA seq 282 aa AA seqDB search
MSLVTSLTYVLPHRLLSSMARALAYSDTPSTKQWLIDTVTRKFGVDLSEALEPDPRAYPT
FNAFFTRALKPGARVPDADPAAVLMPADGRISQLGPIENGRIFQAKGQSFTAAELLGDAE
AAQPFNDGLFATVYLSPKDYHRVHMPWTGTLRETVHVPGRLFSVGPDAVRNVPRLFARNE
RLVCHFDTDFGPMASVMVGALLVSGVETVWSGVEIPRYGDRITRKDYRGKGIVLERFAEM
ARFNYGSTVIVLLPPGVAKLEAGLAAETSVRLGQALAHRQLS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctcgtcacttccctgacctacgtgctgccgcatcggttgctgtcctcgatggca
cgcgcgctggcttattcggatacgccgtccaccaagcaatggttgatcgacacggtgacg
cgcaagttcggcgtggacctgagcgaggcattggagccggatccgcgcgcgtaccccacc
ttcaatgcgttcttcacccgtgccttgaagccgggcgcacgcgtgcccgacgccgacccc
gcagccgtgctgatgccggccgatggccgtatcagccagctcggtccgatcgagaacggc
cgtatcttccaggccaaggggcagtcgtttaccgctgccgaactgctcggcgatgccgaa
gccgcgcagccgttcaacgatgggttgttcgccaccgtctatctctcgcccaaggactac
caccgggtgcatatgccctggaccggcaccttgcgcgagaccgtgcatgtgcccggccgc
ttgttcagcgtgggcccggatgcagtacgtaacgtgccgcgcctgttcgcccgcaacgag
cgcctggtgtgccacttcgataccgacttcggcccgatggcctcggtgatggtgggcgcg
ctattggtgtccggcgtggagacggtgtggagcggcgtggagatcccgcgctatggcgat
cgcatcacgcgtaaggattatcgcggcaagggcattgtgctggagcggtttgcggagatg
gcgcgcttcaactacggatctaccgtgatcgtgttgctgccaccaggtgtcgcgaagctc
gaagctggacttgctgcggagacatcggtgcgtctggggcaagcgctcgcacatcgccag
ctgagctga

DBGET integrated database retrieval system