KEGG   Xanthomonas hortorum: XJ27_11075Help
Entry
XJ27_11075        CDS       T05082                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
xhr  Xanthomonas hortorum
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    XJ27_11075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: ASW46435
UniProt: A0A248YAB3
Position
2517371..2517754
Genome map
AA seq 127 aa AA seqDB search
MQDDPRYRVEVEVSPRFLAHQSTPEEGRYAFAYSIRIQNAGALPARLIARHWQITDANGR
TERVDGEGVVGEQPWLRPGEAFNYTSGVLLETEQGQMQGHYDMVADDGTEFTAPIAAFVL
SVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgatccgcgctatcgggtcgaggtcgaggtgtcgccccgcttcctcgctcat
caatcgaccccggaagaaggccgctatgccttcgcctacagcatccgcatccagaacgcg
ggcgcgctgcccgcgcgcctgatcgcgcgccattggcagatcaccgatgccaacggacgc
accgagcgggtggatggcgaaggcgtggtcggcgagcagccatggctgcgcccgggtgag
gccttcaactacacctccggcgtgctgctggaaaccgagcagggacagatgcaaggtcac
tacgacatggtggccgacgatggcaccgaattcaccgccccgatcgccgccttcgtgctg
agcgtacccaggacgctgcactga

DBGET integrated database retrieval system