KEGG   Xanthomonas hortorum: XJ27_11990Help
Entry
XJ27_11990        CDS       T05082                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
xhr  Xanthomonas hortorum
Pathway
xhr00051  Fructose and mannose metabolism
xhr00520  Amino sugar and nucleotide sugar metabolism
xhr01100  Metabolic pathways
xhr01110  Biosynthesis of secondary metabolites
xhr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    XJ27_11990
   00520 Amino sugar and nucleotide sugar metabolism
    XJ27_11990
Enzymes [BR:xhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     XJ27_11990
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     XJ27_11990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 DUF218 SRP54
Motif
Other DBs
NCBI-ProteinID: ASW46599
UniProt: A0A248YAU8
Position
2731543..2732946
Genome map
AA seq 467 aa AA seqDB search
MSDVLPIILSGGSGTRLWPLSRESYPKQFLPLVGEHSMLQATWLRSAPVAAHAPIVVANE
EHRFMAAEQLQQLGVKPSAILLEPKGRNTAPAIAVAALEATRNGGDPLLLVLPSDHVIRD
EAAFQAAVTVAAAAAEQGKLVTFGIKPTAPETGYGYIKAGAGTGATAVERFVEKPDLVTA
QGYLASGEYYWNSGMFLFRASRYLEELRKFHPAIADACQKAWEGGKRDADFTRLDKDAFA
SSPSDSIDYAVMEKTADAVVVPLDAGWNDVGSWSSLLDVSEQDGQGNAHHGDVIQLDCKN
TYAYGSRLIAMVGLEDVVVVETPDAVLVGHRDRIQEVKDVVGRIKADGRSEATWHRKVYR
PWGAYDSIDMGHRHQVKRITVKPGAVLSLQMHHHRAEHWIVVSGTAEVTRGEEVLLLTEN
QSTYIPLGVTHRLRNPGKLPLELIEVQSGSYLGEDDIVRFEDTYGRT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgtccttccgattatcctgtccggcggttccggcacgcgcctttggccgttg
tcgcgcgaatcgtacccgaagcagttcctgccgctggtcggcgagcacagcatgctgcag
gccacctggctgcgttcggctccggtggccgcgcacgcgcccatcgtggtggccaacgaa
gaacaccgcttcatggcggccgagcagctgcagcagctgggcgtgaaaccttcggccatt
ttgcttgagcccaagggccgcaacactgccccggcaattgccgtcgctgcattggaagcc
acccgtaacggtggcgatccgctgttgctggtgcttccttccgatcatgtcattcgtgac
gaggccgccttccaggctgccgtgaccgtcgcggcagctgccgcagaacagggcaagctg
gtcaccttcggcatcaagccgactgcgcctgaaaccggctatggctacatcaaggccggc
gccggcaccggcgccactgcggtcgagcgcttcgtagaaaaacccgacctggtcaccgcg
cagggctacctggccagcggcgagtattactggaacagcggcatgttcctgttccgtgcc
tcgcgctatctggaagaactgcgcaaattccatcccgccatcgccgacgcgtgtcagaag
gcgtgggaaggcggcaagcgcgatgccgacttcacccgtctggacaaggatgcgttcgcc
tccagcccgtcggattcgatcgactatgcggtgatggaaaagactgccgatgcggtcgtc
gtgccgctggatgccggctggaatgacgttggctcatggtcctcgctactggacgtctcc
gagcaggatggccaaggcaatgcgcatcatggcgatgtcatccagctcgattgcaagaac
acctatgcgtatggctcgcgcctgattgccatggtcggtctggaggacgtggttgtggtg
gagacgccagacgccgttctggtcggtcaccgcgatcgcatacaggaagtgaaggatgtg
gtcggccggatcaaggccgacggtcgctccgaggcgacctggcatcgcaaggtctatcgt
ccgtggggtgcttacgattcgatcgacatgggccaccgtcaccaggtcaagcgcatcacc
gtcaagcccggtgccgtgctcagtctgcagatgcatcaccaccgcgccgagcactggatc
gtcgtcagcggcaccgcagaagtcacgcgtggcgaagaggtgctgctgctcaccgagaac
cagagtacttatattccgcttggcgtgacccatcgcctgcgcaatccaggcaaattgccg
ctggaactgatcgaagtgcagtccggcagctatctgggcgaagacgacatcgtgcgtttc
gaagatacctacgggcgcacctga

DBGET integrated database retrieval system