KEGG   Xanthomonas hortorum: XJ27_17885Help
Entry
XJ27_17885        CDS       T05082                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
xhr  Xanthomonas hortorum
Pathway
xhr00380  Tryptophan metabolism
xhr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    XJ27_17885
Enzymes [BR:xhr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     XJ27_17885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase DUF3390
Motif
Other DBs
NCBI-ProteinID: ASW47617
UniProt: A0A248YDS4
Position
complement(4117947..4118840)
Genome map
AA seq 297 aa AA seqDB search
MPVDKNLRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSEL
WLKLLAHELRAAMVHLQNDQVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVL
GPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPQGQARLREVLEAPSLYEEFLRYLARFG
HAIPQQYQTRDWTAAHVADDALRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRH
MRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGVENRAPSGGEAAKG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcgacaagaacctgcgtgacctggaacccggcattcacaccgatctggagggg
cggctgacctatggcggttatctgcggctggaccagttgctgtccgcgcagcagcccttg
tccgagccggcgcatcacgacgagatgctgttcatcattcagcaccagacctccgagctc
tggctgaagctgctggcgcacgagctgcgcgcagcgatggtgcatctgcaaaacgatcag
gtctggcagtgccgcaaggtgctggcgcgcagcaagcaggtgctacgccagctcaccgaa
cagtggtcggtgctggagacgctcaccccgagcgagtacatgggattccgcgatgtgctc
gggccctcgtcgggctttcagtcgctgcagtaccgctatatcgagttcctgctcggcaac
aagaacccgcagatgctgcaggtgttcgcgtacgacccgcagggccaggcgcggctgcgc
gaggtgctggaagcgcccagcctctacgaggaattcctgcgctatctggcgcgcttcggg
catgcgattccgcagcagtaccagacgcgcgactggaccgccgcgcatgtggccgacgat
gcattgcgtccagtgtttgagcgcatctacgaaaacaccgaccgctactggcgcgagtat
tcgctgtgcgaggacctggtggatgtggaaacccagttccagctctggcgcttccgccat
atgcgcacggtgatgcgggtgatcggcttcaagcgcggcaccggtgggtcgagcggtgtg
gggtttttgcagcaggcgctggcgctgacgtttttcccggagctgttcgacgtgcgcacg
tcggtgggggtggaaaaccgcgcgccgagtggtggtgaggctgcgaagggttga

DBGET integrated database retrieval system