KEGG   Xanthomonas hortorum: XJ27_19480Help
Entry
XJ27_19480        CDS       T05082                                 

Definition
(GenBank) ADP-ribose pyrophosphatase
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
xhr  Xanthomonas hortorum
Pathway
xhr00760  Nicotinate and nicotinamide metabolism
xhr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    XJ27_19480
Enzymes [BR:xhr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     XJ27_19480
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     XJ27_19480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like NUDIX_4 ATP-sulfurylase FAD_syn
Motif
Other DBs
NCBI-ProteinID: ASW47883
UniProt: A0A248YE97
Position
4507005..4508060
Genome map
AA seq 351 aa AA seqDB search
MATQYDYLVFIGRFEPFHNGHAAVARHALGKANKLIVLIGSADTPRTIRNPWTVAERAVM
IESALPGESARLIVRPLRDHLYNESLWIADVQRQVAEAVQADGGTLDARIGLIGMDKDAS
SYYLREFPQWPLEDVQHTATLSATELRRYLFEAGEIGFHGGLLMLRGNVPAPVYDMLEAF
RRNSPSYAQLVAEYRFIEQYRAAWKDAPYAPTFVTTDAVVVHSGHVLLVRRRAEPGKGLW
ALPGGFIGQDEGLLDGCLRELREETRLKVPVPVLKGSLRGRQVFDHPERSLRGRTITHAF
HFEFPAGELPAVRGGDDADKARWIPIAEVIAMGPRLYEDHLHILEFFLGRG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgactatctcgtgtttatcgggcgtttcgagccctttcataacggc
cacgccgccgtcgcccgccacgcgctgggcaaggcgaacaagctcattgtgttgatcggc
tctgccgacacgccccgcaccattcgcaatccgtggaccgttgccgaacgcgcggtgatg
atcgagtccgcgttgccgggcgagagcgcccggttgatagtgcggccattgcgcgaccat
ctctataacgaaagcctgtggatcgccgacgtgcagcgccaggtggcggaagccgtgcag
gccgatggcggcacgctcgatgcgcgcatcggtttgatcggcatggacaaggatgccagc
agttattacctgcgtgagtttccgcagtggccgctggaagatgtgcaacacaccgccacg
ctgtcggccaccgagttgcgtcgttatctgttcgaagccggcgagatcggtttccacggt
ggcttgctgatgttgcgcggcaatgtgccggcgccggtgtacgacatgctggaggcgttc
cggcgcaactccccgagctatgcgcagttggtggccgagtaccgcttcatcgagcaatac
cgcgccgcgtggaaggacgcgccgtatgcgccgaccttcgtcaccaccgatgcggtggtc
gtgcattcgggccatgtgttgctggtgcgtcgtcgcgccgagccgggtaaggggttgtgg
gcgttgccgggtggtttcatcggccaggacgaaggtctgctggacggctgtctgcgcgag
ctgcgcgaggaaacccggctcaaggtgccggtgcctgtgctcaaggggtcattgcgcggg
cgccaggtgttcgatcatcccgagcgcagcctgcgtggacgcaccatcacccatgcgttc
catttcgaatttccggccggcgagttgcctgcggtacgcggcggcgacgatgccgacaag
gcgcgctggattccgatcgccgaagtgattgcgatgggcccgcgcttgtacgaagaccat
ctgcatattcttgaatttttcctgggccgtggctga

DBGET integrated database retrieval system