KEGG   Xenopus laevis (African clawed frog): 100037014Help
Entry
100037014         CDS       T01010                                 

Gene name
fam171a2.S, fam171a2
Definition
(RefSeq) family with sequence similarity 171 member A2 S homeolog
Organism
xla  Xenopus laevis (African clawed frog)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0560 Adeno_E3_CR2 TMEM52 EphA2_TM
Motif
Other DBs
NCBI-GeneID: 100037014
NCBI-ProteinID: NP_001091228
Xenbase: XB-GENE-17339452
UniProt: A1L3I3 A0A1L8EKY1
Position
9_10S
AA seq 821 aa AA seqDB search
MGRARDSGKRSGGPPCSFLLLLLLSCGGGRGKSLLGAAGAQDFHIKVQVYENGDLSPLAS
AAVEIFGNQSSLASGVTDQDGVAVLGISYRLGTWVLVSATKRGFVTNSVPWRVDRLPLYA
SVSLYLVPERPATLILYEDIVQILLGSPGARSQPWVQFQRKAARLPRSSTYNQLTSSLTT
ASTRHQMRGFPAFIGTEPESANGGNTSWVELLPVAAISVHLFSGNGSEVHLSGPVQLSLP
LPPESGLTTSSSVPAWRYEPKVGVWIRSGMGLVRRDGQQLYWSFVSPKLGYWAAAIPSSG
RGMLSLMSGVDIAGYHTIFLLSILGALTLLVLILLCLLIYYCRRRCLKPRQQHHKLQLSG
LSEPKRDQATSTSRLNLISTSHLDSTSTADSDLRTPVLRSAFSSREDFCKSGGRSSFQHS
ADTLPLRPGSRDEYPLKSARSGDLLESEDSKRGYGTGGKGQQRRRGGRGGVRDPPPSPPP
LPPPFKHVIGDSKPPDYLMTQSADPLSRPTSLTQPGQFIFCGSIDHMKEGSYRHAMPTLV
IPAHYMRLSSEENQGGQGEEQSESESGSTQVSHAHHFAPQDHAQRQQLLQQGHGYQQGAT
ASSQDQEGKGWGNHGSVTIPVVFNESTMAQLNGELQALTEKKLLELGVKPHPRAWFVSLD
GRSNAQVRHSYIDLQAGDKTRSNDASLDSGVDVNEIKVKLGPEERSGKAQLQPSNLTYSK
LVFAEEGEQSLSESRTGGGCSPEDSSLTPLLDEGSETCLPMSRRGRSRGDSSRSSTSELR
RDSMTSPDEDLNDQSEGGDDQDKKSPWQKREERPLMVFNVK
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggggcgagcgcgggactcggggaagagaagtggggggcccccctgctcatttctgctc
cttcttctgctcagctgcggggggggccgaggcaaatctctgctgggggccgcgggggct
caggacttccatattaaagtgcaagtgtatgagaacggggacctgtcgcctttggcctcg
gcagcggtggaaatattcggcaatcagagttctctagcgtcgggggtcactgatcaggat
ggagtggccgtattggggatcagctacagactgggcacgtgggtgctggtttcggccacc
aagagaggcttcgtcactaactctgttccctggcgggtggacagactcccactttatgcc
tcagtcagtctctacctggtacctgagcgaccggcgactctcattttatatgaagatatt
gtacagatcctgctgggctccccaggtgctcgcagtcagccctgggtccagttccagaga
aaagccgcccgattgccccgatcctccacctacaaccagctcacctcctcccttaccacc
gccagcacccggcaccagatgagaggattcccagcattcatcgggaccgagccagagagc
gccaatggaggtaacacaagttgggtggagcttctcccggtggcggcgatcagtgtccat
ttgttcagcggcaacggatcagaagttcatctgtccggtcctgtccaactgtctctccct
ctcccccccgaatccggtttaaccacatcgagcagcgtccctgcctggagatacgagcct
aaagttggtgtttggatccgcagtgggatgggattggtgaggagagatgggcagcagctt
tactggtcttttgtgtcgcccaaacttggatactgggcagcggcaattccttcttctggg
cgaggcatgttgtccttaatgagcggagtggacattgctggatatcacacaatcttcctg
ctctccattctgggagctttgactctgctggtgctcatcctgctctgcctcctgatctat
tactgcaggcgacgatgtttgaaaccgaggcaacagcaccacaaactacaactttcgggt
ctgtcagaacccaaacgggaccaggcgacctccacttcccgtcttaacctcatcagcacc
agccacttggattctacatccacagccgacagtgacctacgtactccagttctgagatct
gccttctcgtcccgagaggacttctgcaaatctggaggtcgctcttcatttcagcattcg
gccgacacgcttcctctgaggcctggctctagagatgaatatccgttaaagtctgcccgt
tctggagacttgttggagtcagaagattctaaaagaggctatggtacaggtggcaagggg
cagcagagaagacgagggggcagaggaggggttcgagatccacctccatcacctcctcca
cttcctcctccctttaaacatgtcataggggattcaaagcctccagattatctgatgaca
cagtcagcagatcccctttcacgacctacctcccttacacaacccgggcagtttatattt
tgtggatccattgaccatatgaaggagggtagctatcgacacgccatgcccacattagtg
atcccagctcattacatgaggttgtcttctgaagagaatcaaggcgggcaaggagaagaa
cagtctgagagcgagtctggttccactcaggtctctcacgcccaccactttgctccacaa
gaccatgcccaacgacaacaacttcttcaacaaggccacggttatcagcagggggcaact
gcttcctcacaagatcaagagggtaaaggctggggaaatcatggctcagttaccattcca
gtggtcttcaacgagtccaccatggctcagctgaatggagagcttcaagctttgacagaa
aagaaactattggaacttggggtcaaacctcacccaagggcttggtttgtgtctctggat
gggcgttccaatgcccaggtgcgccactcatacattgacttgcaggctggagacaagact
cgcagcaatgatgccagtttggactcgggcgtagatgtcaatgagattaaagtgaagctg
ggtccggaggaaagaagtggaaaagcacaacttcagccctctaatctaacctattccaag
ttggtctttgcagaggaaggggagcagagcctgagtgaaagtcggaccgggggtggctgt
tcacctgaagacagctctctcactccacttctggatgaaggctcagagacctgccttccc
atgagcaggaggggacgaagccggggtgacagttcccgtagcagcaccagtgagttacga
agggattcaatgactagcccagatgaggacctcaacgatcagtcagaaggtggcgatgac
caagataagaagagtccttggcagaaacgagaagagaggccactaatggtgtttaatgtg
aaataa

DBGET integrated database retrieval system