KEGG   Xenopus laevis (African clawed frog): 100037057
Entry
100037057         CDS       T01010                                 

Gene name
apln.S, Xapelin, apln, apln-a, apln-b
Definition
(RefSeq) apelin S homeolog
  KO
K05225  apelin
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04080  Neuroactive ligand-receptor interaction
xla04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100037057 (apln.S)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100037057 (apln.S)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 100037057
NCBI-ProteinID: NP_001091253
Xenbase: XB-GENE-6255529
UniProt: A1XP38
Position
8S
AA seq 76 aa
MNLRLWALALLLFILTLTSAFGAPLAEGSDRNDEEQNIRTLVNPKMVRNSAPQRQANRRK
LIRQRPRLSHKGPMPF
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaatctcagactttgggcactggcacttctgctcttcattttaaccttgacttcagca
tttggagctccactggctgaaggctcagataggaatgatgaagaacagaatatccggaca
ctggtgaacccaaaaatggtccgtaactctgcacctcaacggcaagccaaccggagaaaa
ctcatacgtcaaagaccccgtctttcacacaagggcccaatgcccttctaa

DBGET integrated database retrieval system