KEGG   Xenopus laevis (African clawed frog): 100101272Help
Entry
100101272         CDS       T01010                                 

Gene name
stxbp1.L, munc18-1, nsec1, rbsec1, stxbp1, unc-18, unc18
Definition
(RefSeq) syntaxin binding protein 1 L homeolog
  KO
K15292  syntaxin-binding protein 1
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    100101272 (stxbp1.L)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    100101272 (stxbp1.L)
Membrane trafficking [BR:xla04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100101272 (stxbp1.L)
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    100101272 (stxbp1.L)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100101272 (stxbp1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec1 YlbD_coat DUF1804
Motif
Other DBs
NCBI-GeneID: 100101272
NCBI-ProteinID: NP_001093335
Xenbase: XB-GENE-945148
UniProt: Q68F22
Position
Un
AA seq 595 aa AA seqDB search
MAPSGLKAVVGEKIMHDVIRKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVED
INKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPSSKYRAAHVFFTDSCPDTLFNELVK
SRTSKMVKTLTEINIAFLPYESQVFSLDYPDSFHSFYSPHKAQMKNPILERLAEQIATLC
ATLKEYPAVRYRGDYKDDAMLSQLIQDKLDAYKADDPTMGEGPDKARSQLIILDRGFDPA
SPILHELTFQAMSLDLLPVENDVYKYETSGIGDQRMKEVLLDEDDDLWVTLRHKHIAEVS
QEVTRSLKDFSASKRMNTGDKVTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQ
GTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDGNVSTYDKIRIILLYIFLKNGIT
DENLNKLIQHAQIPPEDSEIITNMAHLGVPIITDSSLRRRSKPDRKERISEQTYQLSRWT
PVVKDIMEDTIDDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRAGPRLII
FILGGVSLSEMRCAYEVSQANGKWEVLIGSTHILTPQKLLDSLKRLNKTDDESSS
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgagcggactgaaggctgtggtgggagagaagattatgcacgatgtcatccgg
aaggtgaagaagaaaggagagtggaaggtgcttgttgtggatcagcttagtatgcgcatg
ctgtcgtcctgctgcaagatgaccgatatcatgactgaagggattactattgttgaagac
attaataaacggagggagccccttcccagtctggaggcggtgtatctgatcacaccctcg
gaaaagtctgttcactctctcatcagtgacttcaaagatcctccttcatctaaatacaga
gcagcacacgtcttctttactgactcttgcccagatactctttttaatgagttggtcaaa
tctcgaacatccaaaatggtcaagaccctgacggagataaacattgcgttcctcccatac
gagtcacaggtcttctccctggattacccagactcctttcacagtttttacagccctcat
aaggctcagatgaagaatccaattttagaacgccttgcagagcagattgccactttgtgc
gccaccttgaaggagtacccagcagtgcgctaccgtggggattacaaggacgacgcgatg
ctgtcacagttgattcaagataaactggatgcttataaagcggatgatccaacaatgggg
gagggtccagacaaggctcgttcccagctcatcatcttggatcggggttttgatccagca
tcgcccattctgcatgaactcaccttccaggccatgagcctcgacctgctccctgtggaa
aatgacgtatacaaatatgagaccagcggtatcggggatcagcgaatgaaggaagtcctg
ctggatgaagatgacgatctatgggtcaccttgcgtcacaagcacattgctgaagtttca
caggaagtgacccgctccctgaaggatttctcagctagcaaaagaatgaatacgggagac
aaggtgactaccatgagagatctttcccagatgctaaagaaaatgcctcagtatcagaag
gagctgagcaagtactctacacatctgcatctggctgaggactgcatgaagcattatcag
gggaccgtggataaactgtgtcgtgtagaacaggatctggctatgggcacagacgcagag
ggagaaaagattaaggatcccatgagggccattgtaccgatcctacttgatgggaacgtc
agcacctacgataagatccgcatcattctcctgtatatatttctcaagaatggaatcact
gatgagaatctcaataaactgatccaacatgctcagattcctcctgaggacagcgagatt
atcaccaacatggcccatttaggtgtcccgatcataactgattcctcactgcgccgcaga
agcaaaccagatcgcaaggagagaatcagcgagcagacctatcagttgtctagatggacc
cccgttgtcaaagacatcatggaagacaccattgatgacaagctggatacaaaacactat
ccgtacatctctacgcgctcctccgcttcgttcagtaccacagcagtgagcgctcgttac
ggacactggcacaagaacaaggctccaggagagtaccgagcaggcccgcgcctgatcatc
tttattttgggaggagtgtctctcagcgagatgcgctgtgcctatgaggtgtcccaggct
aacggcaagtgggaggtcctgataggctccacccacattctcacccctcagaaactcctg
gattctctgaagagattgaataaaacagatgatgagagcagcagttag

DBGET integrated database retrieval system