KEGG   Xenopus laevis (African clawed frog): 100126631Help
Entry
100126631         CDS       T01010                                 

Gene name
ppif.L, cypf, ppif
Definition
(RefSeq) peptidylprolyl isomerase F L homeolog
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100126631 (ppif.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xla03110]
    100126631 (ppif.L)
Enzymes [BR:xla01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100126631 (ppif.L)
Chaperones and folding catalysts [BR:xla03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    100126631 (ppif.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 100126631
NCBI-ProteinID: NP_001244046
Xenbase: XB-GENE-1008633
Position
7L
AA seq 200 aa AA seqDB search
MLSAASRVVLRCCRIVTGPSYFVASRANSGWSGSHTKNPMVYMDLVADNQPLGRVTFELR
ADVVPKTADNFRALCTGEKGFGYKGSTFHRIIPNFMCQGGDFTNHNGTGGKSIYGSRFPD
ENFILKHTGPGILSMANAGPNTNGSQFFVCTVETEWLDNKHVVFGCIKDGYDVVKKIEGF
GSKTGRPTKKVVIAECGELS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcagctgcaagtcgagtcgtcttacgatgttgccggatcgtcaccggtcccagc
tattttgtcgcttccagagcgaacagtggttggtctggatctcataccaaaaacccgatg
gtatatatggatttggtggcagacaaccagccattgggtcgtgttactttcgagttgcga
gctgatgtggtgccaaaaactgctgataattttagagccctttgtacaggcgagaaaggc
tttggatataagggatctacatttcaccgaatcattccaaattttatgtgccagggtggt
gattttaccaatcacaatggcacaggaggtaaatctatttatggcagccgtttcccagat
gaaaattttattctaaaacacactggaccaggtattctttcaatggccaatgcaggacca
aataccaatggatctcagttctttgtctgtacagtggaaacagagtggctggataataaa
catgtagtgtttggatgcatcaaggatggctatgacgtagtgaagaaaatagagggcttc
ggtagcaagactggtcgtcccaccaaaaaagtagttattgcagaatgtggagaactttca
tga

DBGET integrated database retrieval system