KEGG   Xenopus laevis (African clawed frog): 100126640Help
Entry
100126640         CDS       T01010                                 

Gene name
ddc.L, ddc
Definition
(RefSeq) dopa decarboxylase L homeolog
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00350  Tyrosine metabolism
xla00360  Phenylalanine metabolism
xla00380  Tryptophan metabolism
xla01100  Metabolic pathways
Module
xla_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
xla_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100126640 (ddc.L)
   00360 Phenylalanine metabolism
    100126640 (ddc.L)
   00380 Tryptophan metabolism
    100126640 (ddc.L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    100126640 (ddc.L)
Enzymes [BR:xla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     100126640 (ddc.L)
    4.1.1.105  L-tryptophan decarboxylase
     100126640 (ddc.L)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100126640 (ddc.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 100126640
NCBI-ProteinID: NP_001104211
Xenbase: XB-GENE-1022612
UniProt: A8E606
Position
6L
AA seq 485 aa AA seqDB search
MNASEFRKRGKDMVDYVADYLEQIESRQVFPDVEPGYLRPLIPDSAPEEGETYEDIIKDV
ERVIMPGVTHWHSPYFFAYFPTGNSYPALLADMLCGAIGCIGFSWASSPACTELETVMLD
WLGKMIGLPEQFLAGNKGEGGGVIQGTASEATLMALLAARTKVTRRLQAENPKLTEAEIV
SRMVAYSSDQAHSSVERAGLISGVRMKKIPSDEKFVARGQALKKALEEDKAEGLIPIFFC
ATLGTTNSCAFDNLMELGPVCNAENIWMHIDAAYAGSAFICPEFRYLMEGVEFADSFNFN
PHKWLLVNFDCSAFWVKKRSDLIGAFKMDPVYLQYDQQESGLVTDYRHWQIPLGRRFRSL
KLWFVFRIYGVKGLQAHIRKHVGLAHEFLECVKKDELFEICAPVILGLVCFRLKGSNELN
KALLQKINHSKKIHIVPCCLGDTFVLRFAVCARTVESSHVQFAWKHIKELTTELLNNEKQ
QKTQN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcttccgaattcagaaagagaggcaaagacatggtggactacgttgccgattac
cttgagcagattgaatcaagacaggtttttccagatgtagagcctggctatctcagacct
cttatcccagattctgctccagaggaaggggagacatatgaagatataataaaagatgtt
gagagagttatcatgcctggggttacacactggcacagtccttatttttttgcctacttt
cccactggcaactcatatccagcgctacttgctgacatgttatgcggagcgattggctgc
attggcttttcttgggcttcaagtccagcttgtacagagttggagacagtgatgttagat
tggctggggaagatgataggcttgccagagcagtttttagctggcaacaaaggagaagga
ggtggagttatacagggcactgccagcgaggcaactttaatggcgctacttgctgccaga
acaaaggtaacaaggagacttcaagcagaaaatcccaaattaactgaagcagagattgta
agtcgtatggtggcatactcttcggaccaggcacactcatcagtggagagggctggactg
atcagtggagtacggatgaagaagataccatcagatgaaaaatttgtagctcgtggtcag
gctcttaaaaaagctttagaagaagataaagcagaaggcctcattccaatttttttctgt
gccactcttgggacaacgaattcctgcgcatttgataacctaatggaactgggacctgtc
tgtaatgctgaaaatatatggatgcatattgatgcggcttatgctggtagtgcctttatc
tgcccagaattcagatatctcatggaaggagtggagtttgcagattcattcaatttcaat
ccacacaagtggctcctggttaactttgactgctctgctttctgggtgaaaaaaagatca
gatttaataggtgccttcaaaatggacccagtttatcttcagtacgaccagcaagaatct
ggtttagtaactgattacaggcattggcagatcccattgggaagaaggtttcgctctctg
aaactctggtttgttttcagaatatacggtgttaaagggcttcaagcacatattcgcaag
catgtaggactcgctcatgagtttctggaatgtgtaaagaaggatgagctatttgaaatc
tgtgcccctgtcattctaggtctagtctgttttagattaaagggctctaatgaactgaac
aaagctcttctccaaaaaattaatcattccaaaaaaattcacatagtgccatgttgtttg
ggggacacatttgttttacggtttgctgtctgtgctagaactgtggagtccagccatgta
cagtttgcatggaagcatatcaaagaactcactacggaactcttaaacaacgagaaacag
caaaaaactcagaattaa

DBGET integrated database retrieval system