KEGG   Xenopus laevis (African clawed frog): 100137626Help
Entry
100137626         CDS       T01010                                 

Gene name
tnfrsf1a.S, cd120a, fpf, p55, p55-r, tbp1, tnf-r, tnfar, tnfr1, tnfr55, tnfr60, tnfrsf1a, xtnfr1
Definition
(RefSeq) TNF receptor superfamily member 1A S homeolog
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04060  Cytokine-cytokine receptor interaction
xla04150  mTOR signaling pathway
xla04210  Apoptosis
xla04217  Necroptosis
xla04920  Adipocytokine signaling pathway
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100137626 (tnfrsf1a.S)
   04150 mTOR signaling pathway
    100137626 (tnfrsf1a.S)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100137626 (tnfrsf1a.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100137626 (tnfrsf1a.S)
   04217 Necroptosis
    100137626 (tnfrsf1a.S)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100137626 (tnfrsf1a.S)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100137626 (tnfrsf1a.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:xla04050]
    100137626 (tnfrsf1a.S)
   04090 CD molecules [BR:xla04090]
    100137626 (tnfrsf1a.S)
Cytokine receptors [BR:xla04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100137626 (tnfrsf1a.S)
CD molecules [BR:xla04090]
 Proteins
  100137626 (tnfrsf1a.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death
Motif
Other DBs
NCBI-GeneID: 100137626
NCBI-ProteinID: NP_001108251
Xenbase: XB-GENE-1194114
UniProt: A9CPG4
Position
7S
AA seq 412 aa AA seqDB search
MIGHLMLMVLWLGVIPSYSIDVPLPAAILVKGEPVGITSLLNRQRRSHLENVTEEEKCAD
DEYKHPELNHCCKKCLAGFYRTVHCPEKNQVTQCRPCRTGTFTEVSNSITRCRRCSPCTS
QHGHVIVKNCTQDKDTVCGCHPGQFQFKVASTFICKNCSHCLNGTVSVPCNGYNDTICTC
HFGFYFDRGSRKCLSCDICNDPTCRQHCPPASGLVNPPQENHYWLYALLGLLSVICLAGV
TLFIVRSNLKKCIWNTYKVPPPSNMTDPKSQSESPLLNKTEGSEPVNSISGNIIHMGECV
QVTEGALCKSLPLPDVTQETRHQCFQDPVELYTLVDSIPMPRWKEFARRLGLSDNDIERS
ETDNRRYRDAQYDMLLTWKERVGRCGAKRDAVCKVLREMELAACIEKIQDCL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgattggccacctgatgcttatggtgttatggctcggggttattcccagctattctatc
gacgtcccattaccagcagcaatactggtcaaaggagaacctgtgggaattacatcactt
ctgaatcgacagagaaggtcccacctggagaatgtcacagaagaggagaagtgtgcggat
gatgaatacaaacacccagagctgaatcattgctgcaagaagtgtttggcaggtttctat
aggacagtgcattgtcctgaaaagaaccaagtaacacagtgtcgtccttgcagaactggc
acctttactgaggtatccaacagcataacaaggtgcagaaggtgctctccatgcacttcc
caacatgggcatgtgattgtaaagaattgcacccaggataaggatactgtgtgtggatgt
catccgggtcagttccaattcaaggttgccagtactttcatatgcaagaactgcagccac
tgcttgaatggaactgtgagtgtcccatgtaacggttacaatgacactatctgcacatgt
cactttgggttttactttgatcgaggaagcaggaaatgcctttcttgtgatatatgcaac
gatccaacctgtcggcagcactgtcctcctgcatcagggcttgtaaatccacctcaagaa
aaccattactggctgtatgcgttgctgggactcctatctgtcatatgtttggctggtgta
acacttttcatcgttcgcagtaatttgaagaagtgcatttggaatacttacaaggtgcca
ccaccaagtaacatgacagatccaaagtctcaaagtgaatctccattgcttaataaaacc
gagggctccgagccggtgaattcgatatcaggaaacataatccatatgggggagtgtgtg
caggtgactgagggggctctctgtaagtcgctcccattgcctgatgtcactcaagaaact
cgccaccagtgttttcaggatccagtggaactttacacactagttgacagcatccctatg
ccccgctggaaggagtttgccaggcgtctgggcctcagtgataatgacattgagagatcg
gaaacagataaccggcgctacagggatgcgcaatacgacatgcttctgacttggaaggaa
agggtgggacgctgtggtgcaaaaagagatgcagtttgcaaagtcttgagggaaatggaa
ttagcggcatgtatagaaaaaatccaggactgtctctag

DBGET integrated database retrieval system