KEGG   Xenopus laevis (African clawed frog): 100158368
Entry
100158368         CDS       T01010                                 

Gene name
cpe.L, cpe
Definition
(RefSeq) carboxypeptidase E L homeolog
  KO
K01294  carboxypeptidase E [EC:3.4.17.10]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xla01002]
    100158368 (cpe.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.10  carboxypeptidase E
     100158368 (cpe.L)
Peptidases and inhibitors [BR:xla01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   100158368 (cpe.L)
SSDB
Motif
Pfam: Peptidase_M14 CarboxypepD_reg CarbopepD_reg_2 PEGA AstE_AspA
Other DBs
NCBI-GeneID: 100158368
NCBI-ProteinID: NP_001121285
Xenbase: XB-GENE-952273
UniProt: Q08B06
Position
Un
AA seq 464 aa
MSGIGSSLGLSLVVLLLLGCSTSLTRGRRLSREPGDISFEYHRYPELRDALVSVWLQCPS
ISRIYTVGRSFEGRELLVIEISDNPGEHEPGEPEFKYVGNMHGNEAVGRELLIYLAQYLC
NEYQRENETIVNLIHNTRIHIMPSLNPDGFEKAAQQPGEIKDWFVGRSNAQSIDLNRNFP
DLDRIVYLNEREGGTNNHLMQNLKKSVDENTKLAPETVAVIHWIMDIPFVLSANLHGGDI
VANYPYDKTRSGSAHEYSACPDDSIFKSLARAYSSLNPTMSDPDRKPCRKSDDDTSFIDG
TTNGAAWYSVPGGMQDFNYLSSNCFEITVELGCDKFPQEEKLKSYWEENKDSLVNYLTQV
HRGITGFVKDHHGFPIANATISVDGIDHDVTSAKDGDYWRLLTPGNYKITVSAPGYLAVV
KKVAVPYSPAVKVDFDLESLTERKEEEKEEMMEWWKMMSQTLNF
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgtcaggaataggctcttccctgggtctctcactggttgtgctgctgcttctcggctgc
tccacttccctgacccggggtcgcaggctgagccgggagcccggggacatctcgttcgag
tatcaccgttacccggagctgcgcgacgcgctggtgtctgtgtggctgcagtgtccttcc
atcagtcgcatctacaccgtgggacggagctttgagggccgggagctgctcgtcatagag
atctccgacaaccccggggagcacgagcccggtgaaccagaatttaaatatgttggcaat
atgcatggaaacgaagctgttggaagagagctgcttatatatttagcccagtatttgtgc
aatgagtaccagagggaaaatgaaaccattgtcaatctgatccataacactcgtatccac
attatgccttctctgaatcccgatggctttgagaaagccgcccagcagcctggagagata
aaagactggtttgtaggacgtagtaacgctcagagcatagacctgaacagaaacttccct
gatcttgatcgcattgtgtacttaaatgagcgagaaggaggcacaaacaatcatctgatg
caaaacctgaagaagtctgttgatgaaaacacaaagcttgctccagaaacagtagctgta
attcactggattatggatatcccctttgtcctctctgcaaaccttcatggaggagatata
gttgcaaactatccatatgacaagacacgcagcggaagtgcacatgaatacagtgcatgc
ccagatgacagtattttcaaaagcttagctcgtgcctactcatcccttaaccctaccatg
tcagacccagataggaagccatgccgcaaatctgacgatgacaccagtttcattgacggg
acaacaaatggtgcagcttggtatagtgtgcctggaggtatgcaagattttaattactta
agcagcaattgttttgagataaccgttgagcttggttgtgacaagtttcctcaagaagaa
aagctgaagtcctactgggaggaaaataaagactctctagtgaactatttgacgcaggtg
caccgtggtataacaggatttgtcaaagatcaccatggttttccaattgccaatgctact
atatctgttgatggaattgaccatgatgtgacttcagcaaaggacggtgactactggaga
ctgctgacacctggaaattataaaattacagtttcagcacctgggtatctggctgttgtg
aagaaagtagctgttccttatagcccagctgttaaggttgactttgaccttgagtccttg
acagaaagaaaggaggaagagaaggaagagatgatggaatggtggaagatgatgtcacag
accttgaatttttaa

DBGET integrated database retrieval system