KEGG   Xenopus laevis (African clawed frog): 100158441
Entry
100158441         CDS       T01010                                 

Gene name
ahrr.L, ahh, ahhr, ahrr, bhlhe77
Definition
(RefSeq) aryl-hydrocarbon receptor repressor L homeolog
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    100158441 (ahrr.L)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100158441 (ahrr.L)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_11 PAS_4
Other DBs
NCBI-GeneID: 100158441
NCBI-ProteinID: NP_001121349
Xenbase: XB-GENE-6252735
UniProt: B2KSJ4
Position
6L
AA seq 754 aa
MIPPGECMYAGRKRRKPVQKQRPSAGSEKSNPSKRHRDRLNAELDRLASLLPFPPEIIAK
LDKLSILRLSVSYLKVKNFFQAIEEQHSKKQPSQSVGHAIKEDKTSTGTAMPEGELLLET
LNGFALVVSTEGMIFYASATILDYLGFHQTDVMHQNVYDYIHVDDRQEFCRQLHWAMNPQ
QMEIAQESQTDTGEDVFLNKLFEAEESDSSPSAYSSFLNRCFICRFRCLLDSTSGFLTMQ
FEGKLKFLFGQKKKASSGTIHPPQMAFFCVAVPLLLPPVTEIKTKSVLMKTQKKPGATSN
SENTTKPFPGAYEVEHAGRNSHQGTCFPNILHDPDNQIKLMNSGDNGISFFKVRTNEDQW
VWVEANAPLRYRNGSSDYIVVPQQSEEEMKKQDGVLGLKGNREASLGINDMPALLKHHLP
WGKQEKEDMKVKFQSNKCDSFLQEETSFFQKQISASQNSCPSGAWVGKTSASSRINHQLI
GSFSDRINRPFYSMDQNTPGVHMLGRHHHGNTEHFQSYSGFQQHALDSYPVEHIKLESPF
VNPEVLYDSGLPLTMPIKTENDSDSEGHPELYSECHTHAWLTENNGLKKQLDFSEGLHLK
MESDLSEQTSCLKPKHYMHSSHRSHCYASGTHMNHFNSGRPFKGIYNKDVGQFCPPKCAY
LESVLSLQGADVSNNQFYSVATVDDKSTGNHPYKLQCEFKTHSLVQNIKREPLDSPPWVE
SQQEAVQAIYQKNTLMGFLPSQMPRNAAEFAYIQ
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgattccaccaggagaatgcatgtatgctggaaggaaaagaagaaaaccagtgcaaaaa
caaaggccctcagcaggaagtgaaaaatccaacccttcaaaaagacaccgagatcgtctg
aatgctgagttagatcgtcttgccagtcttcttcccttccctcctgaaattattgcaaaa
ctggataaattatcaattcttcggcttagtgtcagctatctcaaagtaaagaatttcttt
caagcaattgaagaacagcactccaagaagcaaccctcccagtcagtcggtcacgcaata
aaagaagacaagacatccactgggactgccatgccagaaggagagttgttattagaaact
ctgaatggttttgcattggttgtgagtacagaaggcatgatattctatgcatctgcaaca
atactggactatctgggtttccatcagactgacgttatgcatcaaaatgtatatgattat
atccacgtggatgatcggcaggaattctgcaggcagcttcactgggctatgaaccctcag
cagatggaaattgcacaggaatctcagacggacacaggagaagatgtcttcctcaacaaa
cttttcgaagcagaagagtctgattctagcccttcagcatattcatcatttctaaaccga
tgtttcatctgccgtttccgctgcttgttggatagcacttcagggtttctaacaatgcag
tttgagggcaaactgaagttcctctttggtcagaagaaaaaagcatcttcgggaacaatt
catccaccgcagatggcgtttttctgtgtagcagtgccacttctgcttccccctgtcacc
gagattaaaacaaaaagcgtgcttatgaagacacagaaaaaacctggtgcgacttccaac
tcggaaaacacaacaaaacctttcccaggtgcatatgaagtggagcatgctggaagaaac
agtcaccaggggacttgcttccctaacattttacatgatccagataatcagattaaatta
atgaattctggtgataatggaatttcatttttcaaagttcgaacaaatgaagaccagtgg
gtatgggtagaagcaaatgcaccactacgatacaggaatgggagctcagactatatcgta
gttcctcaacaaagtgaagaagagatgaagaaacaggatggtgtacttggtttgaaggga
aatagagaagcatcgctaggtatcaatgatatgccagctctcctgaaacatcatctcccc
tggggtaaacaggagaaagaagatatgaaagtcaagtttcagtcaaacaagtgtgattcc
tttttacaagaagaaaccagttttttccagaaacagatttctgcatcccaaaatagctgc
ccaagtggtgcatgggtagggaaaacttctgccagttccaggataaatcaccaacttatt
ggttcattttcagataggataaataggcctttctatagtatggatcaaaatactcctgga
gttcacatgcttggccgtcaccaccatggcaacactgaacacttccagtcatactctggt
tttcagcagcacgccttagactcctatcctgtagaacatatcaaacttgaaagtcctttt
gtaaatccagaggtactttatgactcagggttacctttgaccatgccaatcaaaacagaa
aatgactctgattcagagggccatccagagctttattctgagtgccatacacatgcttgg
ctaactgagaacaatggactgaaaaaacagttagacttttcagaaggtcttcatcttaaa
atggaatcggatctcagtgaacaaacttcttgtttaaaaccaaagcattatatgcactcc
tctcacagaagtcactgctatgcatcgggcacgcacatgaaccatttcaattcaggaagg
ccatttaaagggatttataacaaagatgtaggtcagttctgccctccaaaatgtgcctat
ttagaaagtgtgttgagtcttcaaggtgcagatgtttcaaacaaccagttttattcagtg
gcgacagtagatgacaagagtactggtaaccacccttataagcttcagtgtgaattcaaa
actcacagccttgttcaaaatatcaagagagagcctcttgattcacctccatgggttgag
agccaacaggaagcggtacaggctatctaccaaaaaaacacattgatgggtttcttgccc
agccaaatgccacgcaatgctgcagagtttgcctacattcaataa

DBGET integrated database retrieval system