KEGG   Xenopus laevis (African clawed frog): 100301954
Entry
100301954         CDS       T01010                                 

Gene name
mecom.S, evi-1, evi1, evi1-B, mecom-a, mecom-b, xEvi-1
Definition
(RefSeq) MDS1 and EVI1 complex locus S homeolog
  KO
K04462  ecotropic virus integration site 1 protein
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100301954 (mecom.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    100301954 (mecom.S)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    100301954 (mecom.S)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 PyrI_C zf-met
Other DBs
NCBI-GeneID: 100301954
NCBI-ProteinID: NP_001154861
Xenbase: XB-GENE-6448217
UniProt: B7ZRM8
Position
5S
AA seq 1050 aa
MKSEDYTYARMAPDIHEERQYHCEECDQLFESKTELSNHQKYSCGTPHSAFSLVENSFPP
ILNDDSDLTEMQHAHECKECDQVFPDMQSLEKHLLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDTGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSECGKTFATSSGLKQHK
HIHSSVKPFVCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFTAGGLFRQGISLPGNTAMDKVSMIGMNHAGLADYFGASRHAAGLTFPTAPGFPF
SFPGLFPSSLYHRPHLIPPASPVKGLPGVEQSNKSQSLHVNQPQVLPATQDILKALNKHH
SVDENKALEFITENNLNQRPHEKVSDHSESTDLDDVSTPSGSDLETTSGSDLESDIESDK
DKLKENGKLYKDKISPLQSLAALNSKREYNNHSVFSPCLEEQTVTGAVNDSIKAIASIAE
KYFGSTGLVGLPDKKGTSLPYPSMFPLPFFPAISQSMYTFPERDVRPLPLKVEPESPKES
KKVQKGTTESAFDLTTKCKEEKASPNAPSKSSAPTSSKHEQPLDLSMGSRSRATTTKQTE
SRKNHIFGEKKDIDSELKKTSEHFLQHARPAPFFMDPIYRVEKRKTMDPLEVLKEKYLRS
SSGFLFHPQFPLPDQRTWMSAIENMAEKLESFNALKPEANDLIQSVPSMFSFRASSSALP
ENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRN
IHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAASSPHSEIEGTGAILEEKEDS
YFNEIRNFIGNNSHNKQSPLNIDERINGSHDKIMLTGQNSDILDDDEIEDEAILEDDEES
DIDVKVMKEPNASAMLKNCSDEFEEESKSEVNCKVSPSRHDDDDDDEEEDFKKSLSALDH
IRHFTDSLKIRKMDDGQFNDAELSPFTASHLTDDLKHPLYRKSKSQTYAMMLSLSDQESM
HPTTHTSSSMWHNLARAAAESTALHSVSHV
NT seq 3153 nt   +upstreamnt  +downstreamnt
atgaagagtgaagattatacctatgcaagaatggctccagatatccatgaggagcgccag
tatcactgtgaagagtgtgatcaattgtttgaatccaagacagagctgagtaaccaccag
aaatactcctgtggtacaccccactcagccttttcactagtggagaacagcttccctcca
atcctaaatgatgacagtgacctcacagagatgcagcatgctcacgagtgcaaagaatgc
gatcaagtttttccagacatgcaaagcctggagaagcacttgctgtcccatacagaggag
agagagtacaaatgcgatcagtgtcccaaggcctttaactggaagtccaacctaatccgc
catcagatgtcacatgatacagggaagcactatgaatgtgaaaactgttccaagcaggtt
ttcacagatcctagcaacctccaaaggcacattaggtcccagcatgttggagcccgtgca
catgcttgttctgaatgcggcaaaacctttgctacatcatcaggtctcaagcaacacaag
cacattcacagcagtgtcaagccctttgtatgtgaagtctgccataagtcatatactcag
ttctccaatctctgtcggcataagcgcatgcatgcggattgcaggactcagatcaaatgc
aaagactgtgggcaaatgttcagcaccacatcatcactaaataagcacaggaggttttgt
gaggggaaaaatcattttactgcaggaggattgtttaggcaaggcatttctcttcctgga
aacacagccatggacaaagtttctatgattggtatgaaccatgctgggcttgcagactat
tttggtgctagtcggcatgctgctggtctcacgttcccaacagctcctggatttccattc
agttttcctggtctgtttccatcaagtctttatcaccgaccccatttgatacctcctgca
tcaccggtgaaagggcttccaggtgttgaacagagcaacaagagtcagagtctccatgtg
aaccagcctcaggtattaccagcaacacaggacattttaaaagcactaaataagcaccat
tctgtagatgaaaataaggctctggagttcataacagagaataatctgaaccagagacca
catgaaaaggtaagcgaccattcagagagtactgaccttgatgatgtcagtactccgagt
gggagtgacttggagacaacctctggctctgaccttgaaagtgacattgaaagtgataaa
gacaaactgaaagaaaatggtaaactatataaggataaaatcagtcctttacagagccta
gctgcactaaatagtaaaagggaatacaataatcattctgttttttcaccatgcttagag
gaacagactgtgacaggggcagtgaatgactctattaaagctattgcttccattgctgag
aagtacttcggttcaacaggactggtagggttgccagataaaaagggcacttcgttacca
tacccttctatgttcccccttccatttttcccagcaatctctcagtcaatgtatacattc
cctgagagagatgtaagaccgttacctttaaaggtggaaccagaatcgccaaaagaatct
aagaaagtgcaaaaggggacaaccgaatcggcctttgatcttactaccaaatgtaaagag
gaaaaggctagcccaaatgcgccctcaaaatctagtgctcctacatcttcaaaacatgaa
cagcctttggacttaagtatgggcagcagaagccgagccactaccacaaaacagacagaa
tccagaaaaaatcatatctttggtgagaaaaaagacattgactcagaactaaaaaaaaca
tctgagcacttcttacaacatgcaagacctgcaccgttcttcatggatcctatatacagg
gtagagaagagaaaaacgatggatcctctggaagttctaaaggaaaaatatttaaggtca
tcctcagggttcttatttcatccgcagttccctctgccagaccagagaacttggatgtca
gcaatagaaaacatggcagaaaaactggaaagtttcaatgccctcaaaccagaagccaat
gaccttatacagtctgttccttctatgttcagttttcgagcttcatcaagtgccctacct
gagaatcttcttcggaagggaaaagaacgctatacttgcaggtactgtggaaagattttt
ccaagatctgcaaatcttactcggcatctacggactcatactggagagcagccttaccga
tgtaaatactgtgatcgttcgttcagtatatcttcaaacttgcaacggcacatccgcaat
atccacaacaaggagaagccgtttaaatgccacctgtgtgacagatgttttggtcagcaa
accaacttggacagacatttaaaaaagcacgaaaatggaaacttatctggcactgcggca
tcttctccccattcagaaatagaaggcacaggcgcgatcttggaagaaaaagaggattct
tactttaatgaaatacggaattttatagggaacaacagccacaacaagcagtccccttta
aatatagatgaaagaattaatggcagccatgacaaaattatgcttactggtcagaattca
gacatattggatgacgatgaaatagaagatgaagcaatccttgaagatgatgaagaaagt
gacattgacgttaaagtgatgaaggaacccaatgcaagtgccatgcttaaaaactgctct
gatgaatttgaagaagaaagtaaatctgaagttaactgcaaagtttcacccagcaggcat
gatgatgatgacgatgatgaagaagaagatttcaagaaaagtctttctgcgttggaccac
ataaggcatttcacagacagtctgaagatacggaaaatggatgacggtcaatttaatgat
gctgagctatcacctttcactgcttctcatctgacagatgacctaaagcatccattgtac
agaaaatcgaaatcacagacatatgcaatgatgctgtctctgtctgatcaggaatccatg
caccctactactcatacttcctccagcatgtggcacaacctagccagagcagctgccgaa
tccactgcactccactccgtgagccacgtatga

DBGET integrated database retrieval system