KEGG   Xenopus laevis (African clawed frog): 100335150
Entry
100335150         CDS       T01010                                 

Gene name
cugbp2-b, etr-3
Definition
(RefSeq) CUG triplet repeat, RNA binding protein 2-b
  KO
K13207  CUG-BP- and ETR3-like factor
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xla03041]
    100335150 (cugbp2-b)
Spliceosome [BR:xla03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100335150 (cugbp2-b)
SSDB
Motif
Pfam: RRM_1 RNA_bind RRM_7 PHM7_cyt
Other DBs
NCBI-GeneID: 100335150
NCBI-ProteinID: NP_001165444
UniProt: Q7ZXE2
AA seq 538 aa
MFERTSKPAFVENICVESMRCPKSAVTMRNEELLFSNGTTNKMNGALDHSDQPDPDAIKM
FVGQIPRSWSEKELKDLFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNA
LHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECR
ILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQ
QQLAQQMQQLNTATWGNLTGLGGLTPQYLALLQQATTPSNLGAFSGIQQMAGMNALQLQN
LATLAAAAAAAQTSATTTNVNPLSTTASALGALTSPVAASTANSSAGAAMNSLTSLGTLQ
GLAGATVGLNNINALAGTVNSMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAAL
PTLYSQSLLQQQSAAGSQKEGLLFISAQGPEGANLFIYHLPQEFGDQDILQMFMPFGNVI
SAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgtttgagcgcacttctaaaccggcttttgttgagaatatctgtgtagaaagcatgcgc
tgtcccaaatctgctgttactatgagaaatgaggagctgcttttcagtaacggcacaacc
aacaagatgaatggagctttggatcactcagaccagccagacccagatgccattaagatg
tttgttggtcagatcccaagatcgtggtcagaaaaagaacttaaggacctttttgagcct
tatggagccgtctatcagatcaatgtccttcgagatcggagtcaaaacccaccccaaagc
aaaggttgttgtttcgtaacgttttatacaagaaaagctgcactagaagcacagaacgct
ttgcacaatattaaaactttacctgggatgcatcatcctattcagatgaaaccagcagac
agtgaaaagtcaaatgctgtggaagacagaaaattgttcattgggatggtttcgaagaaa
tgtaacgagaacgatatcagggtgatgttctctccatttggtcaaatagaagaatgtaga
attcttcggggacctgacgggctgagtcgaggctgtgcgtttgttacattttctacaagg
gcaatggcacagaatgcaatcaaagccatgcaccagtctcagaccatggagggctgttct
tcaccaatagtggtgaagtttgccgatactcagaaagataaagagcagaggcgtctacag
cagcagttagcacagcaaatgcaacagctcaatactgccacttggggaaacctaactggg
cttggaggactgacaccacagtatttagcactcctgcagcaagctaccacccccagtaac
ctgggtgcatttagcggcattcagcaaatggctggcatgaatgctttgcaattacagaat
ttggctactttagcagctgcagcagccgcagcccaaacctcagcaaccaccacaaatgta
aaccctctctctacaacggctagtgcactgggagccctaacaagtccggtggccgcatca
actgctaactcttcagctggagctgccatgaattctttgacatctctgggcacgttacag
ggtctggctggagcaaccgttggactgaataatattaatgcactagcaggtaccgtaaac
agtatggcggctttgaatggaggacttggtgccacaggcttgacgaatggtacagctggt
acaatggatgccctcacccaggcctactcaggaattcaacagtacgcagcggcggcactg
cctacattatacagtcagagtttgttacaacagcagagtgctgcaggcagccagaaagaa
ggccttctttttatttccgctcaagggcctgaaggagcaaatctatttatttaccatctt
cctcaagagtttggagaccaggacatcctacagatgtttatgccttttggaaatgttatc
tctgcaaaagtatttattgacaaacagaccaatctgagcaagtgctttggttttgttagc
tatgacaatcctgtctctgcacaagctgctatccaggcgatgaatggctttcagatcggc
atgaaacgcttgaaagttcagctgaaacgctccaaaaatgatagcaaaccttactga

DBGET integrated database retrieval system