KEGG   Xenopus laevis (African clawed frog): 100380988Help
Entry
100380988         CDS       T01010                                 

Gene name
abhd12.S, abhd12
Definition
(RefSeq) abhydrolase domain containing 12 S homeolog
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xla01002]
    100380988 (abhd12.S)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    100380988 (abhd12.S)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100380988 (abhd12.S)
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100380988 (abhd12.S)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100380988 (abhd12.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 LIP Peptidase_S9 Thioesterase Peptidase_S15 Abhydrolase_2 Chlorophyllase2 RAP
Motif
Other DBs
NCBI-GeneID: 100380988
NCBI-ProteinID: XP_018120616
Xenbase: XB-GENE-990134
UniProt: A0A1L8G1U7
Position
5S
AA seq 386 aa AA seqDB search
MRKRAEPGAPENENFVRAPLDRECSLKQKLRIAGAKGHYPHDSDCDSKEMKRFGRRYGLW
SRLRMFLIFLVGLYIAIPFLVKVCPAIQTQLVFLNLVRFPYFIDLKRPQDQGLNHTCNFY
LQPEEDVSIGVWHTIPAVLWKEAQGKDLEWYEEVLSTNYPVILYLHGNAGTRGGDHRVQL
YKVLSSMGYHVISFDYRGWGDSAGSPSESGMTYDALHAFDWIKARSGDNPVYIWGHSLGT
GVATNLVRRLCERETPPDALMLESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDTITASG
IKFANDDNVKYISCPLLILHAEDDPVIPFHLGKKLYNIAAPARSLRDYKVQFVPFHKDLG
YRHKYIYRSPELHQILRDFLGNNEQQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagagagccgagccgggggccccggaaaatgagaactttgtcagggccccgctg
gacagggagtgcagtctaaagcagaagctgagaatcgctggcgcaaagggccattatcca
cacgactccgactgcgacagcaaggaaatgaagaggttcggcaggcgttatggtttgtgg
tcccggctccgaatgtttctaatctttctagtcggactgtatatagcaattccattcctt
gtaaaggtctgccctgctattcaaactcagctggtgtttttaaatttagtaaggtttcca
tattttattgacttgaagaggcctcaggatcaaggcttaaaccacacatgcaatttttac
ttacagccagaggaggatgtgtccattggagtttggcataccattcctgcagttttatgg
aaagaagctcaaggaaaagacctagagtggtacgaggaggttttatctacaaattaccct
gtgatcctctatctgcatggaaatgccggcacacgaggaggtgatcacagagtgcagctt
tataaggtgctcagttccatgggataccacgtaatttcctttgactacagaggatggggc
gattctgcaggttctccgtcagagagcggaatgacctatgatgctctgcacgcttttgat
tggataaaggcacggagcggagacaatccagtttacatatgggggcactcattaggcaca
ggggttgcaaccaatctagtaagaagactttgtgaaagagaaactcctcctgatgccctg
atgcttgaatctccatttaccaatattcgggaggaggccaagagccatccattttctgtg
atatatagatatttcccaggctttgactggtttttcttagacaccatcacagcaagtggc
attaagtttgctaacgatgataatgtgaaatatatttcctgtcccctgctcatattacac
gcagaagacgaccctgttattccattccatcttggaaaaaagctttacaacatcgcagct
ccggcacgaagtctacgtgactacaaagttcagtttgttccattccacaaagatctggga
tacaggcacaagtacatataccgaagcccagagttgcaccagatactgagggatttcctg
ggaaacaatgagcaacaataa

DBGET integrated database retrieval system