KEGG   Xenopus laevis (African clawed frog): 101027277
Entry
101027277         CDS       T01010                                 

Definition
(RefSeq) acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xla04040]
    101027277
Ion channels [BR:xla04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   101027277
SSDB
Motif
Pfam: ASC EFP
Other DBs
NCBI-GeneID: 101027277
NCBI-ProteinID: XP_018103086
UniProt: G4VV18
Position
2L
AA seq 524 aa
MDVKEAEELSSPQPLAIQAFASGSTLHGLAHIFTYERFSCRRLIWILCFLGSLSLLLFVC
TERIIYYFEYPHVTKLDEISTPKMIFPAVTFCNLNEFRFSRVTKNDLYHAGELLSLLNNR
YELPDSQLADEKVMEILQDKANFRNFKPKPFNMREFYDRTGHDIRDMLLNCKFRGEECSA
DNFVPVFTRYGKCYTFNSGRNGPPLVTTKGGTGNGLELMLDIQQDEYLPVWGETDETSFE
AGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKSSAMDSEFFDT
YSISACRIDCETRYLVENCNCRMVHMPGDAAYCTPELYKECADPALDFLVEKDNDFCVCE
TPCNMTRYGKELSMVKIPSKASARYLAKKYNKSEQYIADNILVLDIFFEALNYETIEQKK
AYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVLRYKLCGGAKCGKDSKRNNNDKGV
TLSLDDVKRHAPIEGVRGHPAGMSYTANILPHHAVRGAFEDFTC
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggatgtgaaagaagcagaagagctgagcagcccccagccattggcaattcaagctttt
gcaagtggatccacactacatggccttgctcacatcttcacatatgagcgcttctcctgt
cgaaggcttatctggatactgtgcttcctgggctccttatctctcctgctattcgtctgc
acagagaggatcatctattactttgagtacccacacgtcaccaaactggatgagatttct
actcctaaaatgatcttcccagcggtgaccttctgtaacctcaatgaattccgcttcagc
cgtgtgacgaaaaatgacctgtatcacgcaggggagctgctcagcctgctcaacaacagg
tatgaactccctgattcacagttggctgatgagaaagtgatggaaatactacaggataaa
gccaacttccgcaatttcaagccaaagccatttaatatgcgcgaattttatgaccgaaca
ggacacgacattcgggacatgcttctgaattgcaagtttcgaggagaggaatgcagtgct
gataactttgttcccgtctttaccagatatgggaaatgctatacttttaactctgggcgc
aatggacctcccttagtgaccacaaaagggggcacagggaacggattagaactgatgctg
gacattcagcaagatgagtatttgcctgtttggggtgagacagatgaaacatcctttgag
gctggaattaaggttcagattcatagccaagatgaacctcctttcattgaccagctgggg
tttggtgtggctcctggatttcaaaccttcgtctcctgccaagaacaacggctaacctac
ttgccccctccatggggcgactgcaaatccagcgcaatggactccgagttttttgatacc
tatagtatctctgcctgtcggattgactgtgagacccggtatttagtggagaactgtaac
tgccgtatggtgcacatgccaggagatgctgcgtactgcaccccggagctgtacaaggaa
tgtgctgatccagcactagatttcctggtggagaaggataatgacttctgtgtatgtgag
actccatgtaacatgactcgctatgggaaggagttgtccatggtgaaaatccccagcaaa
gcctcagcgcgttacctggccaagaagtacaataaaagcgagcagtacatagcggataat
attttggttttggatatcttctttgaagccctaaactatgaaaccatcgaacagaagaaa
gcatatgaggtggctggacttctgggtgacattggaggacagatgggcctgtttattgga
gcaagtattctgactgttctcgaactctttgattatgcctacgaggtgctgagatacaaa
ctctgcggaggagcaaaatgcgggaaggactcaaaacgcaacaataacgataaaggagta
acgctgagtttggatgatgtaaagcgccatgctccaattgaaggtgtaagaggtcaccca
gcaggaatgagttacacagccaacattctgcctcaccatgcagtgcgtggtgcctttgag
gactttacatgctga

DBGET integrated database retrieval system