KEGG   Xenopus laevis (African clawed frog): 101027278
Entry
101027278         CDS       T01010                                 

Definition
(RefSeq) acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xla04040]
    101027278
Ion channels [BR:xla04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   101027278
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 101027278
NCBI-ProteinID: XP_018105659
UniProt: A0A1L8HAF0
Position
2S
AA seq 525 aa
MDVKEAEELGSPQPLAVQAFASGSTLHGLAHIFTYERFSCRRLIWILCFLGSLSLLLFVC
TERIIYYFEYPHVTKLDEIATPNMIFPAVTFCNLNEFRFSRVTKNDLYHAGELLSLLNNR
YELPDSQLADENVMEILQDKANFRNFKPKPFNMREFYDRTGHDIREMLLGCKFRGEECSA
EDFVPVFTRYGKCYTFNSGRNGRSPFVTTKGGTGNGLELMMDIQQDEYLPVWGETDETSF
EAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKSSAMDSEFFD
TYSITACRIDCETRYLVENCNCRMVHMPGDAAYCTPELYKECADPALDFLVEKDNDFCVC
ETPCNMTRYGKELSMVKIPSKASARYLAKKYNKSEQYIAENILVLDIFFEALNYETIEQK
KAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVLKYKLCGGAKCRKDSKRNNNDKG
VTLSLDDVKRHAPCEGVRGHPAGMSYTANILPHHAVRGAFEDFTC
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggatgtgaaagaagcagaagagctgggcagcccccagccattggcagtccaagccttt
gcaagtggatctacattacatggccttgctcacatcttcacatatgagcgattctcctgt
cgaaggcttatctggatactgtgcttcctgggctccttatctctcctgctgttcgtctgc
acagagaggatcatctattactttgagtacccacacgtcaccaaactggatgagattgct
actcctaatatgatcttcccagccgtgaccttctgtaacctcaatgagttccgattcagc
cgtgtgacaaaaaacgacctgtatcatgcaggggagctactgagcctgctcaacaacagg
tacgagctccctgattcgcagttggctgatgagaacgtgatggaaatactacaggataaa
gccaacttccgcaattttaagcctaaaccatttaatatgcgggaattttatgaccgaaca
ggacacgacatccgtgagatgcttctcggttgcaagtttcggggagaggaatgcagtgcc
gaagactttgttccagtctttaccagatatgggaagtgctatacttttaactctgggcgc
aatggacggtctccctttgtgaccacaaaagggggcacagggaatggattagaactgatg
atggacattcagcaagatgagtatttgcctgtttggggagagacggatgaaacatccttt
gaagctggaattaaggttcaaattcatagccaagatgaacctcctttcattgaccagctg
gggtttggtgtggctcctggatttcaaacctttgtctcctgccaagaacaacggctaacc
tacctgccccctccatggggcgactgcaaatccagcgcaatggactctgagttctttgat
acctacagtatcactgcctgtcggattgactgtgagacccgatatttagtggagaactgt
aactgccgcatggtgcacatgccaggagatgctgcatactgcaccccggagctgtacaag
gaatgtgctgatccagcgcttgatttcctggtggagaaagataatgacttctgtgtatgt
gaaactccatgtaacatgacccgctatgggaaggagttgtccatggtgaaaatccccagc
aaagcatcagctcgttacctggccaagaagtacaacaaaagcgagcagtacatagcggag
aatattttggttctggatatcttttttgaagccctaaactatgaaactattgaacagaag
aaagcatatgaggtagctggacttctgggtgacattggaggacagatgggcctgtttatc
ggagcaagtattctgactgttctcgaactctttgattatgcctacgaggtactgaaatac
aaactctgtggaggagcaaaatgcaggaaggactcaaagcgcaacaacaacgataaagga
gtaacgctgagtttggatgatgtaaagcgccatgctccatgtgaaggtgtaagaggtcac
ccagcaggaatgagttatacagccaacattctgcctcaccatgcagtgcgtggtgcattt
gaggactttacatgctga

DBGET integrated database retrieval system