KEGG   Xenopus laevis (African clawed frog): 108696047Help
Entry
108696047         CDS       T01010                                 

Gene name
minpp1.L
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1 L homeolog
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00010  Glycolysis / Gluconeogenesis
xla00562  Inositol phosphate metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108696047 (minpp1.L)
   00562 Inositol phosphate metabolism
    108696047 (minpp1.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108696047 (minpp1.L)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108696047 (minpp1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 108696047
NCBI-ProteinID: XP_018080521
Xenbase: XB-GENE-6489083
UniProt: A0A1L8FIH2
Position
7L
AA seq 489 aa AA seqDB search
MSFLIAPCRSYIPKPFQILLILGTWLCSSALTSVGTWPAGFNFFFGTKTRYEEVNPFLQK
NPLLVIGKQDLLPNTCTPLKIVTVIRHGTRYPTNEQIQKMKKMHDLILKQKGIRSELVEE
LQQWEMWYDDWMDGQLVKKGEQDMRNLAYRLASLFPLLFSEDKLKQSKMTFTTSSKHRCV
DSTKSFISGLVNDYFRFPQTPESGLNELTYMEPVINDTLMRFFDHCPKFLVEVEDNDTAL
HEVDKFKQSPEMKKVIQKLSALLDVPEQELSADLIQVAFFICSFELAIRNIVDSPWCSLF
DEEDARVLEYLNDLKQYWKRGYGYDINSRSSCHLFQHIFQHLETAVTESKSSQQVSMPVV
MHFGHAETLLPFLTLLGLFKDETSLKAENFISQIERKFRSGHIVPYASNLAFVLYLCDMT
ETPNDMTETPREKYQVQLLLNEQLLHFPHSHSSLLFEEMKELYGHLLDGCSISKECAIVK
ANRSSEDEL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagttttctgattgctccttgcagatcttacattcctaaacctttccagatcctcctt
atcttgggcacctggctttgcagctcagcactcacctctgtaggaacctggcctgctggt
ttcaactttttctttggtactaaaacgaggtatgaagaagtcaacccatttctccagaag
aaccctctgctggtcatcgggaagcaggaccttctgcccaacacatgtacccccctcaaa
atagtgactgtgatcagacacggcacccggtatcccaccaacgagcagatccagaagatg
aagaagatgcacgacttgattctgaagcagaagggcatcaggtcggaactggtggaggaa
ctgcagcagtgggagatgtggtatgatgactggatggatggacagctggtgaagaaagga
gagcaggacatgaggaacctggcctataggttggcctccttgttccccttgctcttctca
gaggacaaactaaagcagagcaaaatgaccttcaccacaagctccaagcacagatgtgtt
gacagcacaaaatcctttatcagcggccttgtgaatgactacttccgtttccctcagact
cctgagagtggattaaatgaactaacttacatggaaccagtcatcaacgacactttgatg
cgttttttcgatcactgccctaagtttctggtggaggtggaagacaacgacacggcgctg
catgaagtggataagttcaaacaaagcccagagatgaagaaagtgattcaaaaactctcc
gctcttttagatgtgccggaacaggagctttcagcagatttgatccaagtggcctttttt
atctgctcctttgaactggccattaggaatattgtcgattctccctggtgcagcctgttt
gatgaagaagatgccagggtcctagaataccttaatgacctaaaacaatactggaaacgg
ggctacgggtatgatattaacagccggtccagctgtcacctgttccagcacatcttccag
cacttagaaacagcagtcacagaaagcaaaagctcccagcaggtctccatgccagtggtc
atgcattttggccacgccgagactctcttgccatttctcactctcctgggtctgtttaaa
gacgagacttccctgaaggcagagaacttcattagccagatcgagcggaagttccggagt
gggcacattgtaccgtatgcctctaacctggcctttgtcctgtacctctgtgacatgact
gagaccccgaatgacatgaccgagaccccgagagagaagtaccaggtgcagctgctgctg
aatgagcagctccttcatttcccacattctcattcttccctcctgtttgaggagatgaag
gagctttatgggcacctcctggacggctgctctatctctaaggaatgtgcaatagtcaaa
gccaaccgctcctctgaggacgagctttaa

DBGET integrated database retrieval system