KEGG   Xenopus laevis (African clawed frog): 108697821Help
Entry
108697821         CDS       T01010                                 

Gene name
cacng7.S
Definition
(RefSeq) calcium channel, voltage-dependent, gamma subunit 7 S homeolog
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04260  Cardiac muscle contraction
xla04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108697821 (cacng7.S)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108697821 (cacng7.S)
   04261 Adrenergic signaling in cardiomyocytes
    108697821 (cacng7.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xla04040]
    108697821 (cacng7.S)
Ion channels [BR:xla04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108697821 (cacng7.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 L_HMGIC_fpl Claudin_3 Amastin
Motif
Other DBs
NCBI-GeneID: 108697821
NCBI-ProteinID: XP_018083748
Xenbase: XB-GENE-17340492
UniProt: A0A1L8FHA8
Position
7S
AA seq 275 aa AA seqDB search
MSNCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGIVLQQNQTTEVKMALHAGLWR
VCFVAGREKGRCVASEFFHGPDTDIVTENTANILKTIRSATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGVVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPALYRPRLSDCSDYSGQFLHPEVWHRG
RSPSDISSDVSIQMTQNYPPAIKYPDHIHISTSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattgcagcagccgggcattgaccctactcagtagtgtctttggggcatgtggt
ctccttctagtagggatagctgtaagcactgattactggctctacatggaagaggggatc
gttctgcagcagaaccagacaacagaagtgaagatggctcttcacgcaggactttggagg
gtgtgctttgtagctggtcgggagaaaggtcgctgcgtcgcatcggaatttttccatggg
ccagatactgacattgtaacggaaaatacagcaaacatactcaagacaatccgcagtgcc
accccgtttccgatggtcagcctttttcttgtgttcactgcctttgttataagtaacatt
gggcatattcggccccagagaaccattcttgcttttgtttctggaatcttctttatacta
tctggtctttccttggtggtgggggtggtcctctacatctcaagcatcaatgacgaagtc
atgaaccggcccagtagctcagaacagtattttcattatcgctatggatggtcttttgct
tttgcagcttcatcatttctcctgaaagagggtgctggtgtaatgtcagtctaccttttc
accaaacgctatgctgaagaggaaatgtaccgtccccaccctgccttgtaccgaccccgg
ctcagcgactgctctgactactcaggtcagtttcttcaccctgaggtatggcatcgtggc
cgcagtccttcagacatctccagtgatgtgtcaatccagatgactcaaaactatccacca
gccatcaagtatccagaccacatacacatatctacgtcaccctgctag

DBGET integrated database retrieval system