KEGG   Xenopus laevis (African clawed frog): 108698345Help
Entry
108698345         CDS       T01010                                 

Definition
(RefSeq) cis-aconitate decarboxylase-like
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    108698345
Enzymes [BR:xla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     108698345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 108698345
NCBI-ProteinID: XP_018085257
UniProt: A0A1L8F742
Position
8L
AA seq 498 aa AA seqDB search
MLSSTLQNTKKLQQVCRQLHSAALKVAVSPQYEESVTNTFASFITDIRPEHLSDIVRHRS
KRMILDNIGVGLVGTTTHVFNIILQYCQDLHSSGYGNTAVSSVYGRKDLMLSPTLAAYVN
GVAVHSMDFDDTWHPATHPSGAVVPSILALSQLLSKEKRISGEDLLTAYNVGIEVQGRLM
CFSNEAKSIPKKFHPPSVVGTMGSAAAAAKLLSLNKEQCTHALAIAASLAGAPMANAATL
SKPLHIGNATRLGLEAALLASKGMEANALILDYVPGCSGFSAFYGDYQPKSLSPAGEDYE
FLLEKQDIAFKSFPAHLGMHWIADASVSVRNRLINHYGSFNPSAIQSIILRVPVSKYINR
PYPESEHEARHSFQFNACTALLDGEVNISSFSDDNMHRPDLHSLLKKVVLEHPEDNVANF
DKMYGEVVIVLKDGEVKIGRTDTFYGHWRNPLSRESLLKKFRSNALHVLEEGQVEDVIEM
IEKMESVSDVSQLPLSLQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctctcatccaccctacagaataccaagaaacttcagcaggtatgcagacagctccac
agcgcagctttaaaagttgccgttagtcctcagtatgaagaatctgtcacaaataccttt
gcctcgttcatcactgacattcgccccgagcacctctcggacattgtgcggcacagaagt
aagcgcatgatcctggacaacatcggagtcggcctcgtgggcacaaccactcacgtgttc
aacatcattctgcagtattgccaggatttgcactcttctggctatgggaacacagctgtc
agctcagtgtacggaaggaaagacctaatgctgtcaccaaccctggctgcctatgtcaat
ggagtggcggtccactccatggacttcgatgacacctggcacccagccacccatccttca
ggtgcagtggtgccttccattctggcactgagtcagttgctctctaaagagaagagaatc
agtggggaagacctactaactgcctataacgtggggattgaggtgcaagggaggctcatg
tgtttctccaacgaagccaagagtattcctaaaaagtttcaccctccctcagtggtggga
accatgggaagtgctgcagcagcagcaaaacttctgtcattaaacaaagagcaatgcacc
catgccctggctattgcggcttcgctggccggggctcctatggcaaatgctgcaacactt
tcaaagccgctgcatattggaaatgccaccagactgggtctggaagctgcactgctggcc
tcaaagggaatggaagccaatgctctcattctggattatgttcctgggtgttcaggtttt
agtgctttctatggagattatcagcctaaatcattgtcaccagcaggagaggactatgaa
tttctcctggagaagcaagacattgcctttaagtctttcccggcacatctgggaatgcat
tggatagctgatgcctccgtctctgttagaaacagactgataaaccactatggctccttc
aatccatccgccatccagtctataattctcagagtcccggtatccaaatacatcaacagg
ccttatcccgagtcagaacacgaagcccgtcactctttccagttcaatgcttgcacagct
cttctagatggagaagtcaacattagctccttcagtgacgacaacatgcatcgacctgac
ctccacagcctcttgaagaaggtggtcctggagcatccagaagacaacgtggccaacttc
gataaaatgtacggagaagtcgtcattgtgctgaaggatggagaagttaagataggaaga
accgacacgttctacggtcactggaggaaccctctgagcagggagtctctgctgaagaaa
ttccgctccaatgccctacatgtactggaggagggtcaagtggaagatgtcattgagatg
atagagaaaatggagagtgtgagcgacgtctctcagcttcccctatcacttcagtaa

DBGET integrated database retrieval system