KEGG   Xenopus laevis (African clawed frog): 108698773Help
Entry
108698773         CDS       T01010                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xla01002]
    108698773
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    108698773
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108698773
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   108698773
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108698773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Thioesterase Peptidase_S9 Abhydrolase_2 Abhydrolase_3 VirJ LIP Peptidase_S15 Abhydrolase_8 Transketolase_C
Motif
Other DBs
NCBI-GeneID: 108698773
NCBI-ProteinID: XP_018086037
UniProt: A0A1L8FA15
Position
8L
AA seq 372 aa AA seqDB search
MPQLSTSQRPMFAFGEGDVRLRRKQAGLSYIPEGGGGESRSTGSFGPSSRLALYLKTSAL
ALLCIYISVPFIIRLFPALLAKVVYLNILKVPFSVDLSNPKVILNHTTNFYLTTEDGITV
GVWHTLPASRWEEAKYKDQVWYEEALSDVNPVIIYLHGNGGTRAVDHRVQLVKVLSAAGF
HVLSLDYRGYADSTGEPTEEGITMDSVYLYEWVKARSRGTPVCIWGHSLGTGVATNAARK
LQEKGSAVDVVILESPYTNIREAGAYHPFGRIYHSFPGFEYFFLDTFALNNIVFPNDENV
KLLNAPILILHAEDDAVVPSFMAKKLHDIALKSQNSRGVKLVLFRADLDYEHENIYKDPK
LPEIIWDFLNDI
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagctgtcaacctcgcaaaggcctatgttcgcgtttggggagggtgatgttcgg
ctacggcggaagcaagcagggctttcctacattcccgaaggtggcgggggtgaaagcaga
agcacaggctcgtttgggccttcttcacgcttagccttgtacctgaaaacaagtgctctt
gccctactttgcatctacataagtgtaccattcatcattcgacttttccctgctttgctg
gccaaggtagtttatttaaatatattaaaagttccattttctgtggatctcagcaaccca
aaagtaatactgaaccacactacaaacttctacctcacaactgaagatggaattactgtt
ggtgtttggcatactcttccagccagcaggtgggaagaggcaaagtacaaagaccaggtc
tggtatgaagaggcactatcagatgttaatccagtaatcatttatctccatggaaatggg
ggaacaagggcagtggatcaccgagtgcaactggtaaaggtcctaagtgcagctggattc
catgtattgtcccttgactacagaggatatgctgattctactggagaacccactgaggaa
ggaataaccatggattcagtatatttgtatgaatgggtaaaagctcgctccagaggaaca
ccagtatgtatctggggacattctctaggtactggtgttgctacaaatgcagccagaaag
ttacaggaaaagggaagtgcagttgatgttgtcatattggaatcaccatacaccaacatc
cgtgaagctggtgcttatcatccctttgggagaatctaccacagcttccctggatttgaa
tacttcttcctagacacatttgctctgaacaatatagtgtttcccaacgatgaaaatgtg
aagttgctaaatgcaccaattttaattctacacgcagaagatgatgctgttgtcccgtct
ttcatggccaaaaagcttcatgacattgccttaaaatcacagaattccagaggtgtcaag
ctggttttattccgagcagatctggattatgaacacgagaatatttacaaagatcccaaa
ctaccagaaattatatgggatttcctgaatgacatatga

DBGET integrated database retrieval system