KEGG   Xenopus laevis (African clawed frog): 108698813
Entry
108698813         CDS       T01010                                 

Definition
(RefSeq) A-kinase anchor protein 5-like
  KO
K16522  A-kinase anchor protein 5
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    108698813
Protein phosphatases and associated proteins [BR:xla01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     108698813
SSDB
Motif
Pfam: WSK Csm1
Other DBs
NCBI-GeneID: 108698813
NCBI-ProteinID: XP_018086127
UniProt: A0A1L8FA44
Position
8L
AA seq 510 aa
MSECKGDSSGATREETERGNLPPSLDLMEKTERSTKSSKGYSGMFLRKGKEKKNDHNLSK
DLKVHEKKSVNSSVTKKCEGLCFEEASNEFTCSSSIMESYQLSTNKEARYCFRKLDDGTY
AMEKIEESNPGKNESIPRKKSSKRCQQKGRYSHKPLKICFKKRSKAIRKTSDSIDDYTSE
NKKLHYTNQYEGQTSVSEIQNESTQDGKTWATFKRLVTHKKKRHSSLKQQSQINHETNSN
NTCIRSVSKKKRFSNLKISCMNFSRGKKHATGSMPPQDYAVESQESENRYDCKRSDNPLA
IKYQLQRSLDVENGKTDRNIDQCVYMPSDEFQSLPKLKRVMNHLTQGTNKRNLHKSLRKP
NVESVRSPSLEEREAPCLSAIEKEGMKAIINTRLPQSPVREQDLLCCTIKCSENTANVQK
SGKAELNDLKMSHSYAPQHMAATLQSGNMHESYKNNLNDCEVSSEDDARSSSLLISDPYE
TLLITTSASLVKKVLQASIQQLVDEESPFQ
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtcagaatgtaaaggagattcttcgggtgccacaagggaagaaacagaaaggggtaat
ctacctccatctttggacttgatggagaaaacagaacgaagtacaaaatcttccaaaggc
tattctggaatgtttcttaggaaaggtaaagaaaaaaagaatgaccataatctatccaag
gaccttaaagtgcatgagaaaaagtcagtaaatagttcggtcaccaaaaagtgtgaaggt
ctttgttttgaggaagcctccaacgagtttacttgcagctcttccattatggagtcctat
caactgagtaccaataaagaagctaggtattgcttcagaaaactcgatgatggaacatat
gccatggagaagatagaggaatcaaatcctggaaaaaatgagtcaatacccaggaagaag
tcctcaaaaagatgtcaacagaaagggcgttattcacacaagccattaaaaatctgtttt
aagaaacgaagcaaggccattagaaagacttcagattcaattgatgattatacatcagaa
aacaaaaaactacattatacgaaccaatacgaaggacaaacttcagtatcagagattcaa
aatgaatccacacaagatggaaaaacatgggcaacatttaagaggttggtaactcataaa
aagaaacggcattcatctctcaaacagcaatcccaaataaaccatgaaacaaactcaaac
aatacttgtattcgaagtgtttctaaaaagaaaagattctccaacctaaagatctcgtgt
atgaacttctccagaggaaagaagcatgcaactggcagcatgccaccacaagattatgca
gtagaatctcaagaatctgagaacagatatgactgtaaaagaagtgataacccacttgca
atcaagtatcaacttcaaaggtctttagatgtagaaaatggaaaaaccgaccgcaatatc
gatcagtgcgtgtatatgccttctgatgaattccagtctttaccaaaactcaagagagtt
atgaatcatctcacacaaggtacgaataaaagaaatttgcataaatcacttagaaaacca
aatgtggaaagtgtcaggagcccttctctggaagaaagggaagccccttgtttgtcagcc
attgaaaaagaaggaatgaaagcgataattaatacaaggttacctcagtcaccagttaga
gaacaagatttactttgctgcacaataaaatgctctgaaaatacagcaaatgtgcaaaaa
tctggaaaagctgagctgaatgaccttaaaatgagccacagttatgctcctcaacacatg
gcagcaactctccagagtggcaacatgcatgaaagttacaaaaataatcttaatgactgt
gaagtatcatcagaggatgatgccagaagcagttctctgttaatatcagatccatatgag
acacttttaattacaacatctgcttctcttgttaaaaaagtgctccaggcctctatccag
cagctggttgatgaagaatccccgtttcaataa

DBGET integrated database retrieval system