KEGG   Xenopus laevis (African clawed frog): 108698851
Entry
108698851         CDS       T01010                                 

Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13-like
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xla01002]
    108698851
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     108698851
Peptidases and inhibitors [BR:xla01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   108698851
SSDB
Motif
Pfam: TSP1_ADAMTS Reprolysin ADAM_CR_2 TSP_1 ADAM_spacer1 Reprolysin_4 Reprolysin_3 TSP1_spondin Reprolysin_5 Reprolysin_2 Pep_M12B_propep TSP1_CCN Peptidase_M10
Other DBs
NCBI-GeneID: 108698851
NCBI-ProteinID: XP_018086187
Position
8L
AA seq 1603 aa
MILTGLLLIVLGSLLSTVLCESGCATKKFLHNLEPEELYGYFGATSFLESSVELAEVTCS
CEGSEVPSRCSTLRCTLQSTEERFVFRFPVGPRPIITERVVNASLQRLKHFPEGCGVLGF
VLYPEETKSVISYCEGELRGFIIVDGNQHYVQPLKKKHVLHVKDQKSPHIISRVGKIPPD
SGVPRPAPRIKKRAVGSVKHLELLVVVGHDVYQFHQEDTERYILTNLNIGVELLRDVSLG
TAFRIHLVKLIILTEPEADIQISTNLTSSLISVCKWSHLVNSPDDSDPQHADLVLYVTRF
DLELPDGNKQVRGVTQLGGACSSIWSCVITEDTGFDLGVTMAHEIGHSFGINHDGTGNSC
SRSGNIMASEGYHNSVHLTWSECSREQFLRFLSSGMASCVDDLPAMEGSIPGWKPGLYYG
ADEQCQIAFGSSALACTFSRNDLDSCSVLSCHISQQDRTSCNRLLVPLLDGTECGENKWC
HRGHCSSLEELNPVSVVHGGWASWGSFSSCSRSCGGGVVMRKRQCNNPRPAFGGHTCEGS
NLQADMCNIQACSNTQMDFMNEQCSDTDTKPLYLSPGVPSFYKWTSAVGFADGKALCQYM
CLAQGKRFIVTRGKSFVDGTRCEADKAEFGLCVAGSCRVFGCDGVMGSGTVTDNCGVCGG
ENSTCTKIHGSFSKGKAGEYVSFLTLPPGSMSLKVTNQKPIFTHLGIKVDGVYLVAGKGS
ISLNVTHPSVLEDKAIEYRLFLNTDKLPNLEQIQIKGPTTEEIEIQVYRKYGQEYGDATN
PDIIYRYYIPMKDIEYKWLPVPGPCSASCDRGLSLVSYECSEHDFDQIVQSSLCNDSARP
SSFYEACGVDPCPPRLTTFTYCPRALFPSASLFYNKALRSFYLMPTATTQPVRKHLLPVV
LIPVLPGLTTRNVSCIQFQAGLEVVVEESKCLGQERPMTQVQCVVSVCPVGWDMQIYFPL
SEDSSREQTITEKNMEVYVWSPRVGPCSTSCGTGISELSYICVDFHTKTETVLENCNQTL
KPDTRRNVCNLGTCPPVWELRELGPCPVTCGGATIPLAVICVRKDGNISYPLPHSKCSKI
PRPHTGKPCGMEPCPVRWRYKTGSCSVSCGGGILQRVLYCAKYPQEEESEEQIVSDLECQ
HLPHPQGQEPCNQQPCPPRWKVAEATPCSAACGYGISKQRVVCVQTKDGEEKEMDLGSCA
QQEKPPSLIPCIINCFYSWEVSAWSQCSVTCGNGIQSRQDICSNLKTRQPVSPAFCRNAP
KPITVRGCSAQSCGPDVTTLPPALASTSLVTQLPPRDTILRPQWRSAAIPGEHNIEQNRH
GELGKDNDDEEDGYSLCPLLEPNMVELTILIIPRPSVMMQVCTSSQPLTCSVLSLPGICG
QLFLNSTGVLSTTGLKERDCMFTIGRPLGEVILVRVLSSTLNCTAGELLLFFGRVMWRKT
CARLAGVTLMSRSNTLSVRQRQTQDGNGVVLEYWSKPAAQNYSRECDIQLYGMSGEIQNP
VQPWIEGGSPACRVFIEVAPKYYIAIHALYMDLDTVSIETHPSSILIRDMKTLKSTGFHG
NHLFYWESTGSRAEIEFHGDFSKDRVSFRAQYWAREPQGKGRQ
NT seq 4812 nt   +upstreamnt  +downstreamnt
atgatcctgacgggccttctactgatagtccttggctccctcctttctactgtattgtgt
gagtccggctgtgcgacaaagaaattcttgcacaatctagaacctgaagaattatacgga
tactttggtgcaacatctttccttgaatccagtgtagaactggccgaggtgacatgctca
tgtgaaggctcagaggtaccatctagatgttcaactttgcgttgcacccttcagagcaca
gaggagagatttgtcttcaggttccctgttggacccagacccatcattacagaacgtgtt
gtgaacgcatcactgcagaggctcaaacatttcccagagggctgtggggtgctgggtttt
gtcctgtatccagaagaaacaaaatccgtgatcagctactgtgaaggagaacttcgtgga
ttcatcatcgttgacggaaaccagcattatgtacaacccctgaagaagaagcatgtgttg
catgtgaaggatcaaaaaagtcctcatattatctccagagtagggaagatacctcctgac
agtggtgtgccaaggcctgccccccgaattaagaaacgagcagttggaagtgtgaagcat
ttggagcttttagtggtagtgggtcatgatgtctaccagttccaccaggaggacactgaa
cgatacatcctaaccaacctcaacattggggttgagctgctgagagacgtctcacttgga
accgcattccgtatccatcttgtaaagctgatcatcctgactgaaccggaggcagatatc
caaattagcaccaacctcacctcctcactgatcagcgtctgcaaatggagccatctggtg
aactctccagatgactctgaccctcagcatgcggaccttgttctctatgtgaccaggttt
gatcttgaattaccagatggcaacaagcaggtgcgaggcgtcacccaactcggtggggcc
tgctcatccatttggagttgtgtcattaccgaggacacgggctttgacctgggggtaacc
atggcacatgagattggacacagttttggaatcaaccatgatggaacagggaacagctgc
agcagaagtgggaacatcatggcttcggaggggtaccacaacagcgtccatctcacctgg
tctgaatgcagtagggaacagttcctcagattcctcagcagtggcatggcaagctgtgta
gatgacttgccagccatggagggcagcattcccggctggaagcctggtctgtattatgga
gcagatgaacagtgtcagattgccttcggcagctctgccctggcctgcactttctccaga
aatgacctggattcttgtagtgtcctctcctgccacataagtcaacaagatcgtacaagc
tgcaacagacttctggtcccccttctagatggaacagagtgtggggagaacaagtggtgc
cacaggggacattgcagttcactcgaagagctgaatcctgtttctgtggtgcatggagga
tgggccagttgggggtctttctcctcatgttcccgcagctgtggtggaggagtcgtgatg
aggaaaagacagtgcaacaatcccagacctgcatttggtggacacacctgtgagggttcc
aatctacaggctgatatgtgtaacattcaggcgtgcagcaacacccagatggatttcatg
aatgagcaatgctccgatacagacaccaaacctctctatctcagcccaggagttccctct
ttttacaagtggacttcagctgttggctttgcagatggtaaagcactgtgtcaatacatg
tgtctagcccaggggaagaggttcattgtcactcgagggaagagttttgtggatggtacg
aggtgtgaggcagataaggctgaatttggtctctgtgtagctggaagctgcagggtcttt
ggctgcgatggagtgatgggatctgggacggtgacagataactgtggtgtgtgcggagga
gaaaacagcacatgcactaaaatccatggctctttctctaaagggaaagctggagagtat
gtctccttcttgactcttcctccaggctccatgtctttaaaagtgaccaatcaaaagcca
atttttactcatttggggattaaggtggacggtgtgtacttggtagcaggtaagggaagt
atttctctcaatgtaacccacccatcagtcctggaggacaaggcgatagaataccggttg
tttctgaacacagacaagcttccaaatctagagcaaatccaaattaaaggtcccaccaca
gaagagatcgagatacaggtatacaggaaatatgggcaggaatatggagatgccacaaac
ccggacatcatttatagatactatatacccatgaaggacatcgagtataaatggctccct
gtaccaggaccctgttcggcaagctgtgacaggggtttaagcttagtgtcctatgaatgt
tctgaacatgattttgaccagattgtccagtccagtctctgcaatgattctgcacgcccc
agttctttttacgaagcttgtggggtagatccatgtcctcccaggttgacaacttttaca
tactgccctagggctctgtttccatctgcttcacttttttacaacaaggcattgagatca
ttctacctgatgccaactgcaaccactcaacccgtccggaagcatttgttgcctgtggtt
ttgattcctgtcctgccaggtctgaccacaagaaatgtctcctgtattcagtttcaagct
ggactggaagttgtggtggaggaatctaagtgcttgggtcaagaaaggccaatgacccag
gtgcaatgtgtggtcagcgtgtgtcctgtcggctgggacatgcaaatttacttcccgtta
agtgaagattcctctcgtgaacaaacaattaccgagaaaaatatggaagtctacgtgtgg
agtcctcgggttggaccatgctcaacaagttgtggaacagggatatcagagctcagctac
atctgcgtggatttccacaccaagacagaaaccgtgctggaaaactgcaaccaaactctg
aagccagacacaaggagaaatgtctgtaacctaggaacctgtccacctgtgtgggagttg
agggagcttggtccatgtcctgtgacctgtggaggagcgaccattccactcgctgtgatc
tgtgtaaggaaagatgggaatatctcctatccccttcctcattccaagtgcagcaaaatc
ccccgcccgcacaccggcaaaccttgtgggatggaaccctgcccagtccggtggcgctat
aaaacaggatcttgcagtgtgagctgcggtgggggcatcttgcagagagtcctgtactgt
gccaagtatccccaggaagaagagagtgaggagcagattgtgtcagatctagaatgtcag
cacttgcctcatccacaaggacaggaaccttgcaaccagcagccctgtcccccaaggtgg
aaggtggcagaggcaaccccgtgttcagcagcctgcggatatggcatctctaagcagaga
gtcgtgtgcgtgcagacaaaagatggggaagagaaggagatggacctgggttcttgtgcc
caacaagagaagccaccatcgctcatcccttgcattattaattgcttctactcttgggaa
gtcagtgcctggagtcagtgctcagtcacctgtgggaatggcatccaaagccgccaagat
atttgctccaatctaaaaacccgacaaccggtgagcccagcgttctgtaggaatgcccct
aaaccgatcactgtgcgtgggtgctcagcccaatcctgtggaccagatgtgactactctg
ccaccggccttggcaagtacaagtctggtcacacagctgccaccaagggacaccatcttg
aggccacagtggaggtcagctgcaatccctggggaacacaacattgagcaaaatcgtcat
ggagaactagggaaagacaacgatgatgaagaagatggttactcgttatgtccattatta
gaacccaatatggtagaactcactatactgattataccccgtccttcagtaatgatgcag
gtctgtacaagtagccaaccccttacttgcagtgtcctttctcttccaggtatctgtgga
cagctgttcctcaactctacaggagtactgagtactaccgggctcaaagaaagagattgc
atgttcaccatcgggcgtcccctgggagaggtgattctagtcagagtgttgtccagcact
ctcaactgtactgctggggagctgctgctgtttttcgggcgggtaatgtggcgtaagacg
tgcgcacgcctcgctggggtgactctgatgtctcggtcaaacactctgtctgtgagacag
cgacagactcaagacggtaatggagtggtactggagtattggagcaaaccggctgcccaa
aactactcccgagaatgtgatatccagctttatggaatgagcggagaaatccagaatccc
gtgcagccctggatagaggggggatccccggcatgtagagtgttcattgaagtggccccc
aaatattacattgctatccacgctttgtacatggacctggacaccgtgagcatcgaaacg
caccccagctctattctgattcgggacatgaaaacactgaaatccacaggattccacggg
aaccatttgttctactgggagtcgacggggagtcgggcggaaatagaattccacggagat
ttctccaaagaccgcgtcagcttccgggcgcagtattgggcgcgggaaccacagggaaag
ggtcgtcaatga

DBGET integrated database retrieval system