KEGG   Xenopus laevis (African clawed frog): 108698978Help
Entry
108698978         CDS       T01010                                 

Gene name
jmjd7-pla2g4b.L
Definition
(RefSeq) JMJD7-PLA2G4B readthrough L homeolog
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00564  Glycerophospholipid metabolism
xla00565  Ether lipid metabolism
xla00590  Arachidonic acid metabolism
xla00591  Linoleic acid metabolism
xla00592  alpha-Linolenic acid metabolism
xla01100  Metabolic pathways
xla04010  MAPK signaling pathway
xla04217  Necroptosis
xla04270  Vascular smooth muscle contraction
xla04370  VEGF signaling pathway
xla04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108698978 (jmjd7-pla2g4b.L)
   00565 Ether lipid metabolism
    108698978 (jmjd7-pla2g4b.L)
   00590 Arachidonic acid metabolism
    108698978 (jmjd7-pla2g4b.L)
   00591 Linoleic acid metabolism
    108698978 (jmjd7-pla2g4b.L)
   00592 alpha-Linolenic acid metabolism
    108698978 (jmjd7-pla2g4b.L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108698978 (jmjd7-pla2g4b.L)
   04370 VEGF signaling pathway
    108698978 (jmjd7-pla2g4b.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108698978 (jmjd7-pla2g4b.L)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108698978 (jmjd7-pla2g4b.L)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108698978 (jmjd7-pla2g4b.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     108698978 (jmjd7-pla2g4b.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 cPLA2_C2 EntA_Immun
Motif
Other DBs
NCBI-GeneID: 108698978
NCBI-ProteinID: XP_018086325
Xenbase: XB-GENE-17335405
Position
8L
AA seq 770 aa AA seqDB search
MVQGEEASVFELSVRILQAQNIHTSDTATNPDCYVCLELPTALAEKKRTKTVWNCTDPVW
DETFHFRIHSLIKNILEVSLHDEDISTADDHLLTVSYDLGNVPLNKTVLERFILNKERNE
ELQVEFHICPKMAEIEVQVEKQKYKKKLELELTVLGSYEKSHSLFIPKNYTNSNVNETFA
FHYPRDLGTEFTASLNRVYSSLDVTFGKTLGIQLNMKECPEKLDVRLGFNLCDQEKIFLH
KRQKVVAEAMKKVLQLKGDLVGEEVPVVAIMATGGGARAMSCLYSNLFALKKMGLLDCVT
YIAGASGSTWTMSNLYEDPEWSQNELSEFIHNAKEQVTRTKTKTFSMERLKYYHKELRQA
AMEGQKTSFTDLWGLMIESMFHNGKNESKLSDQQAALQNGQNPLPIYLAINVKQHEISTL
DFKEWCEFTPYEVGLLKYGASIRTEDFGSEFYMGRLMKKNPEPRICYLQGLWGNVFSLNL
IDTWYLTTQVETFWDHWGKDKTNDLDENELRIRKESAHMKTHLFTPPSTFSSILKGILTN
RPIDGEQQNFLRGLHLHKDYIHQSQFCTWKDTDLDSVPNKLTPLEENLCLVDAGYFINAS
FPPLLKPERKVDIIISFDYTLETPLMAVEQTCKYCTTQGIGFPSVSLGEEEKSHHKECYC
FVDDDNPHAPIVLHFPLVNDTFRKYKEPGVLRSEEDMPEGDVDVSGYSPYFLTNFTYSEC
DFDKLMKLTQYNIENNSSTILEALHTAVERRKSKNTFSQMQQTPVKAQQQ
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaggcgaagaagcatctgtatttgaattatctgtaaggattctacaagctcag
aatatccacacatcagatactgctaccaatccagattgctatgtgtgccttgagcttcca
acagctcttgcagaaaagaaaagaacaaagactgtctggaattgtacagatcctgtgtgg
gatgaaacatttcacttcagaatccatagtcttataaaaaacatcctagaagtgtcgttg
catgatgaagacattagcactgcagatgaccatcttctcactgtgagctatgacctgggc
aatgttccacttaataaaactgtgctggagaggtttattctgaacaaagagagaaatgaa
gaacttcaggtagaattccatatttgtcctaagatggctgaaattgaagtccaagtagag
aagcaaaagtataaaaagaaattagagctggagctaacagtgttgggctcttatgagaaa
tcacacagcctattcattcctaaaaattataccaattccaatgtgaatgaaaccttcgcc
tttcattacccaagagacttgggaacggaattcacagccagcttgaacagagtgtactca
tctttggatgtcacatttggcaagactctgggaattcaacttaatatgaaagaatgtcca
gagaagctcgatgtgcgtctaggcttcaatctgtgtgaccaggagaagatatttcttcat
aagagacaaaaggtggtagctgaggcaatgaagaaagttcttcagttaaaaggagatttg
gtaggagaggaggttcctgttgtggctatcatggcgacaggaggaggagctcgagcaatg
tcttgtctttacagcaatctgtttgctttaaagaagatgggccttttggattgtgtcact
tatattgcaggggcttctggatcaacatggacaatgagtaatctttatgaggatcctgaa
tggtcacagaatgagctgtcagaatttattcataatgcaaaggaacaagtcaccagaaca
aaaacaaagacattttccatggagcgtctgaaatattatcacaaagaactgcgacaagca
gccatggaaggccagaaaacgtcttttacagatctatggggcttaatgattgaatcaatg
ttccacaatgggaagaacgagagcaagctttctgatcaacaagctgcacttcaaaatggc
cagaaccctctaccgatttatttagcaataaatgttaagcagcatgaaattagcacactg
gatttcaaagaatggtgtgaattcaccccatatgaagtggggcttctgaagtatggtgcc
tcaatccgcactgaggactttgggagtgagttctacatggggagactgatgaagaagaac
ccagagccccgtatctgctacttgcaaggtttgtggggaaatgtattctctttgaatctg
atagacacctggtatctcaccacacaagtggaaaccttctgggaccattggggcaaagac
aaaaccaacgatttagatgaaaatgaattacgaataaggaaggaatcagcacatatgaaa
actcacctgttcactcctccgagcacctttagttctattctaaaaggaatattgaccaac
aggccaattgatggggaacaacagaactttctcagaggattgcacttacacaaggactat
atccatcagtctcagttttgcacatggaaagatactgatttggattccgttcccaacaag
ctcaccccactggaagagaatttgtgtcttgtggatgctggttattttatcaatgctagc
ttccctcctcttttgaaaccagaaaggaaggtggacatcatcatatcttttgactacact
ctagaaacaccactcatggcagtagaacagacctgcaaatattgtacaacacaaggtatt
gggttccctagtgtgtcactgggagaggaagaaaagagtcaccataaagagtgctattgt
tttgtagatgatgacaaccctcatgcgccaatagtgctccactttcccctggtaaatgac
accttcagaaaatacaaagaacccggtgttctgcgatcagaagaagacatgcctgaagga
gatgtggatgtttctgggtattccccctattttttgacaaactttacctacagtgagtgt
gactttgacaagctgatgaaactgactcagtataatattgagaacaacagcagcactatc
ctggaggccctgcatacagctgtagagagacggaagtccaagaatacctttagccaaatg
cagcaaacaccagtgaaagctcagcaacaataa

DBGET integrated database retrieval system