KEGG   Xenopus laevis (African clawed frog): 108699173Help
Entry
108699173         CDS       T01010                                 

Definition
(RefSeq) cytosolic phospholipase A2 delta-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00564  Glycerophospholipid metabolism
xla00565  Ether lipid metabolism
xla00590  Arachidonic acid metabolism
xla00591  Linoleic acid metabolism
xla00592  alpha-Linolenic acid metabolism
xla01100  Metabolic pathways
xla04010  MAPK signaling pathway
xla04217  Necroptosis
xla04270  Vascular smooth muscle contraction
xla04370  VEGF signaling pathway
xla04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108699173
   00565 Ether lipid metabolism
    108699173
   00590 Arachidonic acid metabolism
    108699173
   00591 Linoleic acid metabolism
    108699173
   00592 alpha-Linolenic acid metabolism
    108699173
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108699173
   04370 VEGF signaling pathway
    108699173
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108699173
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108699173
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108699173
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     108699173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 cPLA2_C2
Motif
Other DBs
NCBI-GeneID: 108699173
NCBI-ProteinID: XP_018086526
Position
8L
AA seq 810 aa AA seqDB search
MNAIADTCEESPLSLLFVKVIRARNIPWADWMSNADCYVSLWLPSSTNKLLKTTTAADTS
DPVWNETFQFKISANMKNVLELTLYDEDAVSQNDLLYKVFIDVAKITAGETLKHSFLLNP
PGGETLEVEFSMKKMPAHPETIVTNGVLVARELCCLDVCVDKQKIPKTLQGEELLLKVEN
SCEKLYKMGLNPTAGPDRTETCSFHSIKRYDSQLSAHLQTAKSEDIESQVNVPLNSLPEG
KEETVRLHAKPEARLEMKVKAQNCKEKLDVRLGFDLCEDEKDFLSKRKKVAAAALKKALK
LDRDLEEDEVPVIAVTTTGGGTRAMTALYGTLSGLKKLNLLDCVFYITGASGSTWAISNL
YENAEWSQKDLDKPIEDARKNVTKDKKSSFTLEKILQYREEMKKRAEMGYRTSFTDIWGL
AIESMFHSGNEKTTLSNQRKALERGQNPLPLCLAMNVKHIENTTMDFKEWCEFSPYEVGL
LKYGAFINSENFGSSFYMGRLIKKLPESRICFLQGLWSNIFSINLMDAWFAAVSSDNFWH
RFTRDNIQDLDGEEALRRKSASPSLATSLLQPAGYIGSTIRDILTSRPIDGEHHNFLRGL
QVHKDYHSHMGFCCFKDTELDTFPNKLTPYSDDLCLVDSAYYINASFPPLLREERKVDVI
LSFDYSLSGRFKSVVQTCDYCTNQKIAFPKVNVTDKDRENPKECHVFTNSKDSEAPILLH
FPLINDTFKTHKEPGVKRSPEEMEGGMVELSGKSPYNLLKLTYSKENFDKLLNLTEYNVM
NNEEAILQSLRDAIAQKQKSRRNSGTNSNH
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaattgccgacacatgcgaggaaagtcctctcagtttgttatttgtcaaagtt
atacgagcccggaacatcccatgggcagactggatgagcaatgccgattgttatgtgtct
ctttggcttccctcatcaacaaacaagttgttgaaaacaacaactgcagcagatacaagt
gaccctgtgtggaatgaaacttttcagtttaagatctctgctaacatgaagaatgtgttg
gagttgaccctttatgatgaagatgctgtttctcaaaacgatctgctctataaagtgttc
attgatgttgcaaaaataactgctggggagacactgaagcacagttttctactcaaccca
ccgggaggagagacacttgaagttgagtttagtatgaagaaaatgcctgctcacccagag
accattgttacgaacggcgtgcttgtggctagagagctgtgctgcttggatgtttgtgta
gacaaacagaagataccaaagactttgcaaggagaagaacttctgttaaaggtggaaaac
tcttgtgaaaaattgtataaaatgggcctgaatccaacagctggtcctgatcgcaccgag
acctgctctttccacagcatcaaaagatatgattcacagctgagtgcccacttacagaca
gcaaaatctgaagacattgaatctcaagtaaacgtgcctctgaattcacttcctgaagga
aaagaagagactgtccgtcttcatgcaaagcctgaggcacgcttggagatgaaggttaag
gcacaaaactgtaaggagaagttggatgttcgcctggggtttgatctctgtgaggatgag
aaagatttccttagtaaaagaaagaaagtagctgctgccgcattaaagaaggctttgaag
ctggacagggacttggaggaggacgaggttcctgtaattgctgttacaacaactggaggt
ggcacacgggcaatgactgccctttatggcaccctgtctggcctgaagaagctgaacctt
ttagactgtgtgttttatataactggggcctctggttctacatgggcaatatcaaatctg
tatgaaaatgctgaatggtcacagaaggacctggacaagccaattgaagatgcaagaaag
aatgtgaccaaagacaaaaaatcctctttcaccttggaaaaaattctccaataccgggaa
gaaatgaagaaaagagcagagatgggatacagaacttccttcactgatatttggggtcta
gcgatagaatccatgttccacagtgggaatgaaaaaaccactctttctaatcagcggaaa
gcacttgaacgtggacagaatcccctgcccctatgcctggcaatgaatgtcaaacacatt
gaaaacaccactatggattttaaagagtggtgcgagttctctccttatgaagttggtctt
ctaaaatatggtgcatttattaattcggagaactttggaagcagcttttacatggggcga
ctaataaagaaacttccagagtcaaggatctgttttctgcaagggttgtggagtaatata
ttttcaataaatctgatggatgcctggtttgctgcagtgagttctgataatttctggcac
cgatttaccagggacaacattcaagatcttgatggagaagaagctttaagaagaaaatca
gcttcccccagtttggcaacttctcttcttcaaccagccgggtacattggcagcaccatc
agagatattctgactagccgaccaattgatggggagcaccacaattttctgagaggactt
caggtccataaagattatcactctcatatgggattctgctgttttaaagatacagaactg
gacacgtttcctaacaagctgactccatactccgatgacctttgcttggttgatagtgcc
tattacattaatgccagcttcccacccttgctacgggaagagcgtaaagtggatgtcata
ctctcatttgattatagcctttcgggaagattcaagtctgtggtacagacatgcgactac
tgcaccaatcaaaaaatagcttttcccaaagtaaatgtgaccgataaagaccgcgagaac
ccaaaggaatgccacgtgttcaccaattcaaaggattcagaggcccccattcttcttcac
tttccacttataaatgacacattcaagacccacaaggaaccaggggtgaagcgcagtcct
gaagaaatggagggagggatggttgaactctcaggcaagtccccttacaacctccttaaa
ctgacttactccaaagaaaactttgacaagctcctgaatctgaccgagtacaatgtgatg
aacaatgaggaagccatcttgcagtccctgcgtgacgccattgcacaaaaacagaagagc
aggagaaacagtggaacaaacagcaatcattag

DBGET integrated database retrieval system