KEGG   Xenopus laevis (African clawed frog): 108702164Help
Entry
108702164         CDS       T01010                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit-like
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04260  Cardiac muscle contraction
xla04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108702164
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108702164
   04261 Adrenergic signaling in cardiomyocytes
    108702164
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xla04040]
    108702164
Ion channels [BR:xla04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108702164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF4199 Claudin_3
Motif
Other DBs
NCBI-GeneID: 108702164
NCBI-ProteinID: XP_018093161
Position
9_10S
AA seq 319 aa AA seqDB search
MRCCSLILRGTRFLTDSSANSFLLILLLITQIFPCTSQELMVCGMGACSRKALTLLSSVF
AVCGLGLLGIAVSTDYWLYLEEGIILLQNQTTEIKMSLHSGLWRVCFLAGEEQGRCFTIE
YVMPMNVQMTSESTVSVLKMIRSATPFPLVSLFFMFIGFILNNVGHIRPHRTILAFVSGI
FFILSGLSLVVGLVLYISSINDEILNRTKDSETYFSYKYGWSFAFAAISFLLTESAGVMS
VYLFMKRYTAEDAYRPHPGFYRPRLSNCSDYSGQFLHPEAWVRGRSPSDISSEASLQMNS
NYPALLKCPDYDQMSSSPC
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgctgcagcctcatccttagaggcacaaggttcctgactgacagctcagccaac
agcttcctcctcatcctcctcctcattacacagatattcccttgtacaagccaggaactg
atggtctgtggcatgggtgcttgtagcaggaaagccttgactctgctcagcagtgtgttt
gctgtgtgtgggctggggcttctgggaatcgctgtcagcactgactactggctgtacctg
gaggaagggatcatcttactgcagaaccagaccactgagatcaaaatgtcccttcattct
ggcctgtggcgggtctgttttttagcaggggaagagcagggtcgctgctttaccatcgag
tatgtcatgcccatgaatgtccagatgacttctgaatccacagtcagtgttctaaaaatg
attcgttctgcaacaccattccctttggttagcctcttctttatgttcattggattcatc
ctcaacaatgtgggtcacatcagacctcacagaacaattctggcctttgtttccggaatt
ttcttcattctctctggtctgtctctagtagtgggcttagtactctacatatccagtatc
aacgatgagatcttgaatcgaacgaaagattctgagacgtatttcagctacaagtacggc
tggtcctttgcctttgcagccatatcatttctcctaacagagagcgctggagtcatgtcc
gtctacctgttcatgaagagatacacggcagaagatgcctacaggccccacccaggtttt
tatcgcccgcggctcagcaattgctctgattattctggtcagttcctgcacccagaggcc
tgggtgagaggtcggagtccctcagatatctccagcgaggcatctctccagatgaactcc
aactacccggccctgctcaaatgccctgactatgaccaaatgtcctcatctccatgctga

DBGET integrated database retrieval system