KEGG   Xenopus laevis (African clawed frog): 108704620
Entry
108704620         CDS       T01010                                 

Definition
(RefSeq) acid-sensing ion channel 1-like
  KO
K04829  acid-sensing ion channel 1
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xla04040]
    108704620
Ion channels [BR:xla04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   108704620
SSDB
Motif
Pfam: ASC COX4
Other DBs
NCBI-GeneID: 108704620
NCBI-ProteinID: XP_018096740
Position
Un
AA seq 546 aa
MNAITRVSYTSSNPCRICLSRLMDMLKPPEDEEGDDEPKPSDLTVFASNSTLHGISHVFL
PGGVTPRRVFWACSFLASLSCFLFQVADRIIYYSEYHHVTTLDEMESSLMKFPALTICNY
NSFRKSALTRNDLFWVGDLLGIDKDSPEALEALGIPEESGPFYPTKSYNMQEFYERTGHL
MDDMVLECRYRNQECGAENFTVIYTRYGKCYTFNSGQEGYELLYTLKGGMGNGLELMLDI
QQDEYLPVFGETDETSLEAGVKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQQQELVYLP
RPWGDCRSDPLDSPYFKTYSITACRIDCESRYIFEKCKCRMVHMPGNATVCSPDQYECAD
SQLDFLVEEDNTYCVCDTPCRTVRYGKELSMVKIPSKASARYLARKYNKSEQYIAENILV
LDIFFEALNYETIEQKKEYEMAGLLGDIGGQMGLFIGASILTILEIFDYLYEPKPHSTSN
SSTASTNEQEVEDNSPEMSSFSSSSSSSSWVLILRHDKQAESYESPDYSRWEPIGPLTCT
MGHGPH
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgaatgcaataacccgtgtttcatacacttcctctaatccttgcaggatttgcctctcc
agactgatggacatgctgaagcccccagaggatgaggaaggagacgatgagccgaaaccc
tccgacctgacggtgtttgcaagcaactccactctccatgggatcagccatgtcttcctg
cctggtggggtgacccctcgacgagtcttctgggcatgttccttcctggcctctctcagc
tgcttcctcttccaagtggccgaccgcatcatctactacagtgagtaccaccatgtcacc
accctggatgagatggagagcagcctcatgaaattcccagccctcaccatctgcaactac
aacagctttcgcaagtctgccctgactagaaatgacctcttctgggtgggggatttgctt
ggcattgacaaagactccccagaagcattggaggcgttggggatacctgaagagtctgga
cccttctatccaaccaagtcgtacaatatgcaagagttctatgagcgaactggacatctc
atggatgatatggtgctggaatgccgctaccgaaatcaggaatgtggagccgagaacttc
actgtgatctacacccgctatggcaagtgctacaccttcaactccggccaagaaggatac
gaacttctctacaccctcaaaggcggcatggggaacggcctggagctcatgttggacatt
cagcaggatgagtacctacctgtgtttggagagacagatgagacgtcccttgaggctggg
gtgaaggtccagatacacagtcaggatgaacccccatttatagaccagctggggtttggt
gtggcccctggatttcagacgtttgtgtcgtgccaacagcaagaactggtgtacctgccc
cgtccatggggagactgtagatctgaccctcttgactctccgtacttcaagacctacagt
atcacagcttgtcgtatcgattgtgaatcccggtacatctttgagaagtgcaagtgtcgg
atggtgcatatgcccggtaatgccaccgtgtgcagccctgaccagtatgagtgtgcggac
agccagctagatttcctagtagaggaggacaacacttattgtgtgtgtgacaccccctgc
cgcacagtaagatacggaaaagagctgtcaatggtaaagatcccgagcaaggcgtcagca
agatacttagcccggaaatataacaaaagcgaacaatacatagcggagaatattctggtt
ttggacattttctttgaagcattaaactatgagacaattgagcaaaagaaggagtatgag
atggctggacttctgggagacatcgggggccagatggggctatttattggcgctagcatc
ctcacaatattggaaatctttgattatctctatgagcccaaacctcattcaacctcaaat
tcctcaacagcctcaactaatgagcaggaggtggaggacaactccccagaaatgtcgtct
ttttcatcatcatcatcatcatcatcatgggttttaatattgcgacatgacaaacaggct
gaatcttatgagagtcctgactactcccgctgggagccaataggccccctgacatgtacc
atgggccacggaccccactga

DBGET integrated database retrieval system