KEGG   Xenopus laevis (African clawed frog): 108704686Help
Entry
108704686         CDS       T01010                                 

Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2-like
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00230  Purine metabolism
xla01100  Metabolic pathways
xla04270  Vascular smooth muscle contraction
xla04540  Gap junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108704686
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108704686
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108704686
Enzymes [BR:xla01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     108704686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB DUF4761
Motif
Other DBs
NCBI-GeneID: 108704686
NCBI-ProteinID: XP_018096863
Position
Un
AA seq 585 aa AA seqDB search
MTKNATKKLIVIVGIKFEELQERFGEEFFSICFEENERVLRAVGGTLHDFFNGFDALLEH
IRTSIGRQITFESPSFLCKELADGTLLLSCFHLPHIVGLAMKGMIKAAGKRIYQLKVVVE
QVNNVNEKLCSEITKPGNFNFLTFKIKGCDNANIIKAPLLQLSQVPSDLRISISTFCRAF
PFHLMFDPNMLILQLGEGLRKMIKCEVQKTMKFHDCFEIVSPKISCTFEHVLLRLSTPFV
IRNKPDASSFENKDKVMEVKGQMIHVPESSSILFLGSPRVDKLDELMGRGLHLSDIPIHD
ATRDVILVGEQAKAQDGLKKRMDKLKATLEKTHQALEEEKKKTVDLLYSIFPGDVAQQLW
EGKSVQARKFDDVTMLFSDIVGFTAVCAQCTPMQVISMLNELYTRFDYQCGFLDIYKVET
IGDAYCVAAGLLRKSNSHAKPIALMALKMMELSEEVLTPDGRPIKMRIGIHSGSVFAGVV
GVRMPRYCLFGNNVTLASKFESGSHPRRINISPTTYQLLKDEETFHFVSRSREELPENFP
IEIPGICYFLEANSGQKQPKHSLTSVRMRKVSYNIGTMYLRETSV
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgactaagaatgctactaagaaactcattgtgattgtaggcataaagtttgaagaattg
caagagagatttggtgaggagttcttcagtatctgctttgaggagaatgaaagggtcctc
cgagcggtgggaggtacactacatgacttcttcaatgggtttgatgctttattggaacac
attaggacttcaattggaagacagattacttttgaatccccttctttcctatgcaaagag
cttgctgatgggaccctacttctcagctgcttccatcttcctcatattgttgggttggcc
atgaaaggtatgataaaggcagcaggaaagaggatctaccagttaaaagttgtggttgaa
caagtgaacaatgtgaatgaaaaactatgctctgaaatcacaaaaccgggtaacttcaac
tttcttacctttaaaattaaaggatgtgacaatgcaaatatcattaaagcacctctactc
caattgtcccaagtcccatcagacttgaggataagtattagcactttctgcagagctttt
cctttccatctgatgttcgatccaaacatgctgatcctgcagcttggggaaggactcagg
aagatgataaaatgtgaggttcaaaaaacgatgaagtttcatgactgttttgaaatagtg
tctccgaaaatcagttgcacgtttgaacacgtcctcttgagattgtcaaccccctttgtc
atacggaataaaccagatgcatcctcttttgaaaataaagacaaggtgatggaagttaaa
ggacaaatgattcatgttcctgagtccagttctattttgtttttgggatccccccgagtt
gacaaactggatgaactgatggggagaggcttgcatctttctgatatccccatacatgat
gccacgcgggatgtaatactagttggcgagcaagctaaagctcaagatggtcttaagaaa
cgaatggataaactgaaagccaccttagaaaagacacaccaggccctggaagaagagaag
aagaagaccgtggatcttctctattcaatattccctggagatgtggcccagcagttatgg
gaagggaagtctgttcaggccaggaagtttgatgatgtcaccatgctcttttccgacatt
gttggcttcactgctgtttgtgcccagtgcactccaatgcaagtaatcagcatgttgaat
gaactatatactcgatttgactatcagtgtggcttcctggacatatataaggttgaaaca
attggagatgcttactgtgtagcagcgggactcctaaggaagagcaacagtcatgccaag
cccatcgctctcatggctttgaagatgatggaactttcagaagaagtcctcactcctgat
ggaagacctattaagatgagaatcggaattcactctggctctgtctttgctggtgttgtt
ggtgtaagaatgccacgttattgcctgtttggaaataatgtcactctggctagtaaattt
gaatcaggaagccatcctcgtagaataaacatcagtccgacaacataccaactattgaaa
gatgaagaaactttccactttgtatcccgttcacgtgaggagcttccagaaaactttcca
atagaaatacctgggatttgctatttcctggaggccaacagtggtcagaagcagccaaag
cattctttaacatctgttagaatgagaaaggtttcctacaacatcggcactatgtacctt
agggagacaagtgtatga

DBGET integrated database retrieval system