KEGG   Xenopus laevis (African clawed frog): 108705672Help
Entry
108705672         CDS       T01010                                 

Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    108705672
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    108705672
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    108705672
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108705672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 108705672
NCBI-ProteinID: XP_018098036
UniProt: P84233 A0A1L8G0S1
Structure
PDB: 

Position
Un
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtactaaacagaccgcccgcaagtccaccggagggaaggctcctcgcaaacag
ttggccactaaggcagccaggaagagcgctccggccactgggggtgtcaagaagccacat
cgttaccgcccaggtactgtcgctctccgagaaatccgacgttaccagaaatccactgag
ctgctgattcgcaaattgcctttccagcgcctcgttcgtgagatcgctcaggatttcaag
actgacttgcgtttccagagctcggccgtcatggctctgcaggaggccagcgaggcttat
ctggttggcttgtttgaggacaccaatctgtgcgccatccatgccaagagggtcaccatc
atgcccaaggatatccagttggcccgcaggatccgaggcgagagagcttag

DBGET integrated database retrieval system