KEGG   Xenopus laevis (African clawed frog): 108706698Help
Entry
108706698         CDS       T01010                                 

Definition
(RefSeq) ethanolamine-phosphate phospho-lyase-like
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00564  Glycerophospholipid metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108706698
Enzymes [BR:xla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     108706698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 108706698
NCBI-ProteinID: XP_018098828
UniProt: A0A1L8HM06
Position
1S
AA seq 509 aa AA seqDB search
MAEEYTKAKIMEMRKKHIGPSCKVFFANDPIKIVRARGQYMFDEKEARYLDCINNVAHVG
HSHPEVTKAALKQMELLNTNSRFLHDNLVRYAECLTSTLPEKLSVCYFVNSGSEANDLAL
RLARQYTGHQDVITLDHAYHGHVTSLIDISPYKFHQLGKDAQKEYIHVAPPPDTYRGKYR
EDHPDPASAYAKEVDYIIKKAHQNKRQIAAFIAESMQSCGGQIIPPAGYFQKVSEFVHKA
GGVFIADEVQVGFGRVGKHFWSFQLQGEDFVPDIVTMGKPIGNGHPMSCVVTTKEIAEAF
GATGMEYFNTFGGNPVSCAIGLAVLDIIEKEDLRGNATTVGNYLTELLIEQKQKHPLIGD
IRGVGLFVGVDLVKDRLLRTPATAEAQYIIYKLKEKRILLSADGPHRNVLKFKPPMCFNK
EDAKLVVDEIDQCLTALEKAIGIQSNAGLHEKNPAKRKVHHENSGSTNTKDEETCSSNLQ
DSNPNDNACRQSNGLHPESPTVTRKRIRT
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggagtacaccaaggcaaaaatcatggaaatgagaaaaaagcacattgggccc
tcgtgcaaagtgttttttgcaaatgatccaatcaagattgtgcgtgcaaggggacagtac
atgtttgatgaaaaagaagcgagatacttggactgcataaataatgttgctcacgttggt
catagtcaccctgaggtaacgaaggctgctttaaaacagatggaattgctaaacaccaat
tccaggtttctacatgacaaccttgtccggtatgctgagtgccttacatccacccttcca
gagaagctttcagtctgctattttgttaactcaggctcagaagccaatgaccttgcactg
cgtctggcacgacagtacactggccatcaggatgtgataactctcgatcatgcctaccat
ggacatgtaacttccctgattgatattagtccttataaatttcaccagctgggaaaggat
gcacagaaggagtatatacatgtggctcctcctcctgatacttacagaggaaaatacagg
gaagatcatccagaccctgcatcagcttatgctaaagaagtagattatatcattaagaaa
gctcatcagaacaaacgtcagattgctgcttttattgctgagtccatgcagagttgtgga
ggtcaaataatcccaccagcaggctacttccagaaagtgtcagagtttgtccataaagca
gggggagtcttcatagcggatgaagttcaagttggctttggaagagttggcaaacatttt
tggagcttccagctacaaggagaagattttgtaccagatattgtcaccatgggaaagcca
ataggcaatgggcacccaatgtcctgtgttgtaactacaaaagaaattgcagaagccttt
ggagcaactgggatggaatactttaatacgtttggaggaaatcctgtatcctgtgcaatt
ggactggccgtgctggatattattgaaaaagaagatctcagggggaatgctactacagtg
gggaattatttgactgagctattgattgagcaaaaacaaaagcaccctttaataggagac
atcagaggggttggcttgtttgtcggtgtggatttggttaaggacagattgcttagaact
cctgcaactgctgaggcccagtatataatatataagttaaaagaaaaacgaatcctactg
agtgctgacggccctcacagaaatgttctgaaattcaagcctccaatgtgctttaacaag
gaggatgctaaactggttgtagatgaaattgatcaatgtcttacagctcttgaaaaagca
ataggaatccaatcaaatgctggtttacatgaaaaaaacccagccaagagaaaggtgcat
catgaaaattcagggagtaccaacacaaaagatgaggaaacatgttccagtaacttacaa
gatagcaatccaaacgacaatgcctgcagacaaagcaacgggctgcatcctgaaagcccc
acagtcacacgtaaaagaataagaacataa

DBGET integrated database retrieval system