KEGG   Xenopus laevis (African clawed frog): 108707037
Entry
108707037         CDS       T01010                                 

Definition
(RefSeq) adenylate cyclase type 4-like
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00230  Purine metabolism
xla01100  Metabolic pathways
xla04020  Calcium signaling pathway
xla04114  Oocyte meiosis
xla04261  Adrenergic signaling in cardiomyocytes
xla04270  Vascular smooth muscle contraction
xla04371  Apelin signaling pathway
xla04540  Gap junction
xla04912  GnRH signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108707037
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108707037
   04020 Calcium signaling pathway
    108707037
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108707037
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108707037
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108707037
   04914 Progesterone-mediated oocyte maturation
    108707037
   04916 Melanogenesis
    108707037
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108707037
   04270 Vascular smooth muscle contraction
    108707037
Enzymes [BR:xla01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108707037
SSDB
Motif
Pfam: Guanylate_cyc
Other DBs
NCBI-GeneID: 108707037
NCBI-ProteinID: XP_018099444
Position
1S
AA seq 238 aa
MENLNRVLLENVLPADVAQQFIGQNRRNEDLYYQSYDCVCVLFASIPDFKEFYTECDENH
EGLECLRLLNEIIADFDELLSKPKFSSVEKIKTIGSAYMAATGLNATSGQENPQDGDRNY
NHIGIMVEFAIALIGKLDLINKHSFNNFKLRIGINHGPVVAGVIGAQKPQYDIWGNTVNV
ASRMDSTGVLGKIQVTEETTKVLEKLGYKCERRGVIKVKGKGQLCTYFVSTDMARSGS
NT seq 717 nt   +upstreamnt  +downstreamnt
atggagaacctcaatagagttttgcttgagaatgttttgccagcagatgtagcccagcag
tttattgggcagaaccgtagaaatgaggacctgtattaccagtcatatgactgtgtctgc
gtcttgtttgcctccatccctgactttaaggaattttacacagaatgtgatgagaatcat
gaaggcttggaatgtctaaggctgcttaatgagatcatagcagactttgatgagctgctc
tcaaagccaaaatttagtagtgtggaaaaaattaagaccattggtagtgcatatatggca
gcaactggacttaacgctacatcagggcaagagaacccacaggatggagacagaaattac
aatcacattggtatcatggtcgaatttgccattgctttaattggaaagctggatctaatc
aataaacactcatttaataacttcaaactgagaattggcattaaccacggtcctgtggtg
gctggagtgataggagcccaaaagccacagtatgatatatggggtaacacagtaaatgta
gcaagtcgtatggacagcactggtgtgttgggtaaaatccaggtaacggaagaaaccacc
aaagtcctagaaaagttgggatataaatgtgaacgacgaggagttatcaaggttaagggg
aaaggacagctctgcacctattttgtatccactgatatggcacgatcaggttcctag

DBGET integrated database retrieval system