KEGG   Xenopus laevis (African clawed frog): 108707763Help
Entry
108707763         CDS       T01010                                 

Definition
(RefSeq) matrix metalloproteinase-18-like
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xla01002]
    108707763
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     108707763
Peptidases [BR:xla01002]
 Metallo Peptidases
  Family M10
   108707763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_4 Reprolysin_3 Reprolysin_5 Metallopep DUF4953 Peptidase_M66
Motif
Other DBs
NCBI-GeneID: 108707763
NCBI-ProteinID: XP_018101231
UniProt: A0A1L8HJ80
Position
2L
AA seq 472 aa AA seqDB search
MKSWFLFLLCVACCTAFPARIQTDSNQNNEAVAKEYLKKFYKFEEDGISKSGQLSNSAFL
DKIHQMQEVFGLVASTRLDEETLAIMKQPRCGVPDVGSFSIFGGNAVWKKKDLTYRIQNY
IPQMTRDEVDQAIQKAFKVWSDVTPLTFTRIYDGVSDIEMLFASKDHKDSLPFDGPFGVL
AHALAPGDKMGGDVHFDADEKWTSGSAGVNLFLVAAHELGHSLGLDHSKESNALMFPNYH
YINPNTFQLSGDDINGIQSLYGPKEKAVVPTKASPPKKASVPINCQESKSFDAATTLRGD
ILFFKNRYLLRKIAGKSEAEQFEINSFWPSLPTDLDAAYEYQKKDRVLLFKGTKYWVLRG
YTIEEGFPKNIYELGFPLTVTKIDAAVHSEETRRTYFFVNDRYWSYNEEKAQMDKESPQR
IRNGFLDVGNKVEAAFQSNGMLYLFSGNQQYEFSMIKKKVNRLLKYTSWLNC
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcctggtttctgttcctactgtgtgtagcatgttgcacggcattccctgctagg
atacagacagactccaatcagaacaatgaagcagttgctaaggagtacttgaaaaaattc
tacaaatttgaggaggatgggatctccaagtcaggacaacttagcaatagtgcatttttg
gataaaattcatcagatgcaagaagtttttggattggtggcctctacaagactggatgaa
gaaaccttagcaataatgaaacaacctcgttgtggtgtccctgatgttggcagttttagc
atctttggaggaaatgctgtgtggaagaaaaaagacctgacatacagaattcagaactat
attccacaaatgaccagagatgaggtggaccaggccattcagaaggctttcaaagtctgg
agtgatgtcacccctcttacctttaccagaatctatgacggtgtctccgatattgagatg
ttgtttgcatctaaagatcataaagattctctcccttttgatggtccatttggtgttctg
gcacatgcacttgctcctggagataagatgggtggagatgtacattttgatgcagatgag
aaatggacaagtggatcagctggtgttaacttgttccttgtggctgctcatgaacttggc
cattcccttgggcttgatcactctaaagaatcaaatgcccttatgttcccaaactaccat
tacatcaatcccaatacattccagctttctggggatgacatcaatggaatccaatcactg
tatggaccaaaagaaaaggcagttgtgccaactaaagcaagccctccaaaaaaagcaagc
gtccccataaactgtcaggagagcaaatcttttgatgcagccacaacactgcgaggggac
attctgttttttaaaaacagataccttttgcgcaagattgccggtaaatcagaagctgag
cagtttgagatcaattcattctggccttcccttccaactgaccttgatgcagcctatgaa
tatcagaaaaaagaccgggttcttctctttaaaggaacaaaatactgggttctaagaggc
tacacaattgaggagggattccctaagaacatctacgaacttggctttcccttgactgta
acgaaaattgacgcagctgtccacagtgaagaaacaaggagaacttatttctttgttaat
gatcggtattggagttataatgaagaaaaagcacaaatggataaagaatctccccagaga
atcagaaatggtttccttgatgttggaaacaaggtggaggcagcctttcaatcaaatgga
atgctctatttgttcagtgggaatcagcagtatgaattcagcatgataaagaagaaagtc
aatcgtctgctaaagtacaccagctggctgaactgctaa

DBGET integrated database retrieval system