KEGG   Xenopus laevis (African clawed frog): 108708533Help
Entry
108708533         CDS       T01010                                 

Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial-like
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00020  Citrate cycle (TCA cycle)
xla00640  Propanoate metabolism
xla01100  Metabolic pathways
xla01200  Carbon metabolism
Module
xla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108708533
   00640 Propanoate metabolism
    108708533
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    108708533
Enzymes [BR:xla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     108708533
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     108708533
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108708533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 108708533
NCBI-ProteinID: XP_018102831
UniProt: A0A1L8HHL7
Position
2L
AA seq 460 aa AA seqDB search
MAASIMYSRLSAGLRSRAPRAALGSAVQVLSGFPGVFGCHGVQAQQHRNLSLHEYLSMDL
LKNAGVAIPKGCVAKTPDEAYTAAKEIGSKDLVVKAQVLAGGRGKGTFEGGLKGGVKIVY
SPEEAKDIASQMIGKKLFTKQTGEKGRICNHVFICERRYPRREYYFAIAMERAFQGPVLI
GSSHGGVNIEDVAAENPDAIVKEPIDIVEGIKKEQAVRLAEKMGFPTNIVDEAANCMINL
YNLFMKYDATMVEINPLVEDASGVVMCMDAKINFDSNAVYRQKEVFDLRDWSQEDERDRQ
AAKADLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATVHQVTEAFRL
ITSDKKVLAILVNIFGGIMRCDVIAQGIIMAVKDLELRIPIVVRLQGTRVDDAKALITAS
GLKILACDDLDEAAKMVVKLSEIVTLAKQAQVDVKFQLPI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccataatgtacagccggctgtcagctggattgaggagtcgggcgcctcgc
gcagctctcggttctgcagtgcaggtactcagtggatttcctggagtgttcgggtgccat
ggtgtccaagcacaacaacatcggaatctgtctcttcatgagtatctgagcatggacctt
ctgaaaaatgctggtgttgccatcccaaaaggctgtgttgcaaaaacaccagatgaagct
tatacagcagctaaagaaattggttcaaaggatctggttgttaaagcacaagtattagct
ggcggcagaggcaaaggcacctttgaaggcggtttaaaaggaggagtgaagattgtttat
tcacctgaagaagccaaagacatcgcatctcagatgattgggaagaagcttttcacaaaa
cagacaggtgaaaagggcaggatatgcaatcatgtgtttatctgtgaacgaaggtatccc
agacgagaatactactttgcaattgctatggaaagggcattccaaggccctgtactaatt
ggaagttcccacggtggtgtaaatattgaggatgttgctgctgaaaacccagatgccatt
gtaaaggaacccattgatattgttgaaggaataaagaaagagcaagctgtcaggcttgca
gagaaaatgggcttccctacaaatatcgtggatgaagctgcaaactgtatgattaatctt
tataatctctttatgaaatatgatgctactatggtcgaaattaacccgttggtagaggat
gcatcaggggttgtaatgtgcatggatgcaaagataaactttgactccaatgcagtttat
cgacagaaggaagtgtttgatctgcgggactggtcacaggaagatgagagagacagacaa
gctgcaaaagctgatcttaactacattggtctagatggcaacattggatgtcttgtgaat
ggggctggtttggctatggcaacaatggatataataaaacttcatggaggtacacctgca
aacttcttagatgttggaggtggtgccacagttcatcaagtaacagaagcatttagactt
attacatctgataaaaaggttcttgctatactagtgaatatattcggtggtatcatgaga
tgtgatgtaattgctcagggtatcattatggctgtcaaggacttggaacttaggatacct
attgtagtccgtttgcaaggtacaagagttgatgatgccaaagcacttataacagccagt
ggactaaaaatacttgcatgtgatgatttggatgaagctgcaaaaatggttgttaaactt
tcagaaatcgtaacgctggcgaaacaagcacaagtcgatgttaaatttcagttgcccatc
taa

DBGET integrated database retrieval system