KEGG   Xenopus laevis (African clawed frog): 108708743Help
Entry
108708743         CDS       T01010                                 

Gene name
mtmr2.L
Definition
(RefSeq) myotubularin related protein 2 L homeolog
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00562  Inositol phosphate metabolism
xla01100  Metabolic pathways
xla04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108708743 (mtmr2.L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    108708743 (mtmr2.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    108708743 (mtmr2.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     108708743 (mtmr2.L)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     108708743 (mtmr2.L)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    108708743 (mtmr2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Y_phosphatase DSPc 3-PAP Y_phosphatase3 DUF2968
Motif
Other DBs
NCBI-GeneID: 108708743
NCBI-ProteinID: XP_018103259
Xenbase: XB-GENE-6489000
UniProt: A0A1L8HJA3
Position
2L
AA seq 570 aa AA seqDB search
MEELLLLPGESVKDIAKDVTYICPFSGAYRGSFTVTSYRLYFRSLERDRRLILDAPLGII
SRIEKIGGAASRGENPNGIEIVCKDMRNIRFAYKQDLLTRKSVFENLMKFSFPLNYGLPL
FAFEYKEVFPENGWKVYDPIQEYRRQGIPNESWRISRVNERYDLCDTYPASLVVPANISD
HELRKISAFRAQDRIPVLSWIHPESQAAITRCSQPLPGVNGKRSKEDEKYLQSIMDANAQ
SHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRESQRKLKEISYP
SIQEANWLSNLESTHWLEHIKLILSGALRIADKVESGKTSVVVHCSDGWDRTPQLTSLAM
IMLDGYYRTIRGFEVLVEKEWVSFGHRFYQRIGHGDKNHADADRSPVFLQFIDCVWQMTR
QFPHAFEFNEHFLLTILDHLYSCLFGTFLCNCELQRLKEGVVEESVSLWSFINNQLEDFT
NPLYVNYSSHVLYPVTSTRNLELWAGYYIRWNPRTRPQEAIRSQYKVLLAKRAELQKRLE
DLQREISNRSTSSSDRGSSPQPVTSVQTVV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcttctcttactgccaggagagtccgttaaggacatcgccaaagacgttaca
tacatctgcccattcagcggcgcgtatcggggaagcttcacggtcaccagttaccgactt
tatttcagaagcctggaaagggaccgacgcctcatcctggatgcccccctcggcatcatc
agcagaatagagaaaatcgggggagctgccagccgtggggaaaatcccaatggcatagaa
attgtctgcaaggatatgcgaaacatccgctttgcctacaaacaagacctgctcacccga
aaatctgtattcgagaatctcatgaagttctcctttccgttaaattacggcttgcctctc
tttgcgttcgagtacaaagaagtgtttcctgaaaacggctggaaggtctacgacccgatt
caggaatacaggcggcagggcattcccaatgaaagctggagaatttcccgtgtgaacgag
cgatatgatttgtgcgacacctacccagcaagtttggttgtgccggcaaatatctccgat
cacgaactgagaaaaatatccgctttcagggcgcaggatcggataccggtattgtcatgg
attcaccctgaaagccaggccgctataactcggtgtagccaacccttgccgggagtcaat
ggcaagagaagcaaagaggatgaaaagtacctgcagtctatcatggatgccaacgctcag
tcccacaaaatcttcatctttgatgcaaggccgagtgtcaatgcggtggcaaataaggct
aaaggcggggggtacgagagtgaagacgcgtatcagaacgcagagttggtcttcctggat
atccataatattcacgtgatgagagagtcgcagaggaaactcaaggagatctcgtacccg
agcattcaggaggcaaactggctgtctaacctggagtctacccactggctggagcatatc
aagctgatcctttccggtgccttaaggattgcggataaagtggaatcggggaagacgtcg
gtggtggtgcactgcagtgatggttgggaccgcactccccagctcacttccctggccatg
atcatgctcgatggctactaccggactatccgaggctttgaggtgctcgtggagaaggag
tgggtcagctttgggcacagattctatcagagaattggtcacggagataagaatcacgcg
gatgccgacaggtcgcccgtgttcctgcagttcatcgactgtgtttggcagatgacccgg
caattcccacatgcctttgaattcaacgagcactttttactgaccattctggatcacctg
tatagctgcttgtttggaacgttcctctgtaactgtgagctgcagagactcaaggaggga
gtggtggaagaatccgtctctctctggtccttcatcaacaaccagctggaggattttaca
aatccattgtacgtgaactactccagtcatgtgttgtacccggtcaccagtactcggaat
cttgaactctgggctggatactatataaggtggaatcctagaacaagaccacaggaggcc
atcaggagtcaatataaagtcctcctggccaagcgggcagagcttcagaagcgcttggaa
gacctacagcgagagattagcaaccgctcaacctcatcgtctgatagaggaagctccccc
caacccgtcacttccgtgcaaactgtcgtataa

DBGET integrated database retrieval system