KEGG   Xenopus laevis (African clawed frog): 108709322Help
Entry
108709322         CDS       T01010                                 

Gene name
mtmr4.S
Definition
(RefSeq) myotubularin related protein 4 S homeolog
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00562  Inositol phosphate metabolism
xla01100  Metabolic pathways
xla04070  Phosphatidylinositol signaling system
xla04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108709322 (mtmr4.S)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    108709322 (mtmr4.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108709322 (mtmr4.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    108709322 (mtmr4.S)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     108709322 (mtmr4.S)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     108709322 (mtmr4.S)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     108709322 (mtmr4.S)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    108709322 (mtmr4.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE DSPc Y_phosphatase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 108709322
NCBI-ProteinID: XP_018104547
Xenbase: XB-GENE-17343209
Position
2S
AA seq 1091 aa AA seqDB search
MSETPPRLHCSVLSCFGDEPPSLEYIQAKDLFPPRELVKEEDKLQVPFPVLPGEGVEYLG
SANDAVIAISNYRLHIKFKDSVINVPLRMIETVESRDMFQLQIICKDSKVVRCHFSTFKQ
CQEWLKRLGRATFRPAKQEDLFAFAYHAWCQGVCIDEEEPLIHLCRPGDHVKSRFQIELV
RMGFDLQNAWRVSEINNNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHT
RTGAVIARCSQPEISWWGWRNADDEYLVTSIAKACALNPAVRTPNGNPSNKGISDGSDNS
DTDFDSSLTACPVDGGGVPQKLLIVDARSYTAAVANRAKGGGCECEEYYPNCEVAFMGMA
NIHSIRNSFQYLRAVCNQVPDPGNWLSALESTKWLQHLSAMLKAATVVANAVDREGRPVL
VHCSDGWDRTPQIVSLAKLLLDPYYRTLEGFQVLVETDWLDYGHKFADRCGHQENTEDQN
EQCPVFLQWLDCIHQLLLQFPCHFEFNHAFLVKLVQHTYSCLYGTFLANNLCEREMRNIY
KRTCSVWSLLRTGNKNFHNLLYMPGSDLVLHPVCHVRALHLWTAVYLPTTSPCTPMDDRM
EMYLTPASQGPEFNARSLDRLPKTRSMDNLLTACDSGGLLTRTSSDPNLNNHQGSLEPCS
SNKEGNETEICDMQQQVLSTEPKKEDGNEGKSADCENEETGVARIPKNQQNALNNILSIA
KADSVDCKCDNFKSVQENSSVIAVPSNEGTIADNSHSNGTSEHLPVPALVKNGSVQNKSC
VNVSKAMKLSTELSRTDKKPVFQAQPDEFSLFASNWDSLPGLMRSVPLCEVALRRPLSYD
CSTRSQHNRNGRHTTKLTANLPASFHCPGPFNRSSRCVMTCHAKQVQSGRFLPLACPSPA
PLIYQDDDGLPIPSDVVQQRLRQMEASYKQEVDLLRRQVWELQLQLEIRQYCAPPSEPEA
DYEDDFTCVKESDGSDMDDLYSDKSEDRLSEASWEPVDKKETEVTRWVPDHMASHCFNCD
CEFWLAKRRHHCRNCGNVFCAACCHLKLPIPDQQLYDPVLVCNTCYDHIQVSRARELMSQ
QLKKPLTAASS
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaccccgccgcgccttcactgctcggtgctcagctgcttcggtgatgagccc
cccagtctagaatatattcaggccaaggatctctttccaccaagggaacttgtaaaggag
gaggacaaactgcaggtaccattcccagtgctgccgggggaaggagtggagtatttagga
agcgcaaatgatgctgtcatagctatctctaattatcgtttgcacatcaagtttaaagat
tctgttatcaatgtgcctttaaggatgattgagacagtggagagtcgggatatgttccag
ctgcagataatatgcaaggattctaaagtagtcaggtgccacttttccacatttaagcaa
tgccaggaatggctgaagcgactaggcagagcgacatttcgtccagcaaaacaagaagat
ctttttgcatttgcttatcatgcctggtgccagggggtatgcatagatgaggaggagcct
ctgatacacctttgtcgtcctggagaccatgtgaagtcccgatttcagatagaacttgta
cgcatggggtttgacttgcaaaatgcttggagagtgtctgagatcaacaacaactacaaa
ctctgcccaagctatcctcagaagcttcttgtgccagtttggatcacggataaggaatta
gagaatgttgcttccttcagatcatggaaacgcatccctgttgttgtgtacaggcataca
cgcacaggagcagtgattgcacggtgcagccagcctgagattagctggtggggctggcgt
aatgcagatgacgaatatcttgtaacttctattgcgaaagcctgtgctctgaatccagca
gtacgtacgcctaatggaaacccctctaacaaaggcatcagtgatggaagtgacaattca
gacaccgactttgattcttccttgacagcctgccctgttgatggtggaggtgtacctcag
aaactactcatagtagatgccaggtcttacacagctgctgtggccaaccgagcaaaagga
ggcggatgtgaatgtgaagaatattatccaaactgtgaagtggcattcatgggaatggct
aatatccactcaattcggaacagctttcaataccttagagctgtgtgtaaccaggttcca
gacccaggaaactggctctcagcactggaaagcacaaagtggctacagcacctgtctgcc
atgttgaaagcagcaacagttgtggctaatgcagtggacagggaagggcggcccgtgctg
gttcattgctcagatggatgggacagaacaccgcagatcgtatctctggcaaaacttctg
ctggatccatattatcgaactttagaaggattccaggtattggttgaaacggattggtta
gattacggtcataagtttgccgaccgatgtggccatcaggaaaatacagaagatcaaaat
gaacaatgtccagtcttcctgcagtggctagattgtatccatcagctgctactccagttc
ccatgtcactttgagtttaaccatgcttttctggtgaaactagtgcaacacacatattca
tgcctgtatggaaccttccttgccaacaacttgtgtgagcgagagatgcgcaacatttac
aagagaacttgctcagtttggtccctgcttaggaccggcaacaaaaattttcacaactta
ttgtacatgcctggaagtgatctggttctgcacccagtttgtcatgttcgagctcttcat
ctttggacagctgtgtatctgccaacaacatcaccttgtactcctatggatgataggatg
gaaatgtatcttacccctgcttcccagggaccagagtttaatgccagatccctcgacagg
ttaccaaaaacccgatcaatggacaatcttctgactgcgtgtgacagcgggggactactg
acacgcacatctagtgaccccaaccttaataaccatcagggcagcctagagccatgcagt
tccaacaaggagggtaatgagactgaaatttgtgatatgcagcagcaggttttatcgacc
gagcccaagaaagaagatggaaatgagggtaaaagcgccgactgtgaaaatgaggagaca
ggagttgctcgaattccaaaaaatcaacaaaatgctcttaacaatattttatcaatcgcc
aaagcagattctgtagattgcaaatgcgataattttaaatctgttcaggaaaacagttct
gttatagcagtgccaagcaatgaagggacaatcgctgacaatagccacagtaatggcacc
tcagagcacctcccagttccagccttggttaaaaatggatctgttcaaaacaagtcctgt
gtaaatgttagcaaagctatgaaactctctactgaattgtctaggactgacaaaaagcct
gtgtttcaagcacagccagacgaattctctttatttgcatccaactgggacagtttaccg
ggtctgatgagatctgttcctctctgtgaggttgctctgcgacgccctctctcctatgac
tgttctacaaggagtcagcacaacaggaacggaagacatactaccaaactaaccgcaaac
ttgcctgcctcttttcactgccctgggccctttaatagaagctccaggtgtgtgatgact
tgtcatgcaaagcaggtacagagcggcagattcttgcctttggcatgtccatccccagct
ccactcatttaccaggatgatgatggtttgccaattcccagtgatgtggtacagcagaga
ctccggcaaatggaagcaagttacaaacaagaagtagatctgcttcgacggcaggtgtgg
gaattgcagctccagttggagatccgtcagtattgtgctccaccttctgaaccagaagca
gactatgaagatgattttacttgtgtaaaagagtctgatggtagcgatatggatgacctc
tattcagataagagtgaagaccgactctctgaagcaagttgggagccagtggataaaaag
gaaactgaggtaacaagatgggttcctgatcacatggcttcacattgctttaactgtgac
tgtgaattctggctggcaaaacgtaggcatcactgcagaaattgtggtaatgtgttctgt
gcagcctgttgccatttgaagctccccatacctgaccagcagctgtatgaccctgtgctt
gtgtgcaacacgtgctatgatcacatccaagtgtcccgtgcaagggaacttatgtctcag
cagctgaagaaacccctcactgcagcctcaagctga

DBGET integrated database retrieval system