KEGG   Xenopus laevis (African clawed frog): 108709705Help
Entry
108709705         CDS       T01010                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108709705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    108709705
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108709705
Protein kinases [BR:xla01001]
 Serine/threonine kinases: STE group
  STE20 family
   108709705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr DUF2477
Motif
Other DBs
NCBI-GeneID: 108709705
NCBI-ProteinID: XP_018105259
Position
2S
AA seq 1396 aa AA seqDB search
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNSLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFNFIEGCLVKNYTQRPPTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKKRMEEMERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLE
ILQQQLLQEQAMLLEYRWREMEEHRQAERLQRQLQQEQAYLMSLQHDHRPQQPPQQPQPQ
QPALSQQERSKQSYHIQEPKPHHEQAERIREAEERLRKANQGSPEAQAKQPGRVLEPSVP
SRSESFSNGNSEPAQPAMHRPVEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAPHLLR
SQDSHQTSRSEVQSQSSDPKSETSEPAQRVWTRSDSEEVPPRVPVRTTSRSPVLSRRDSP
LQGSGQQNTQTGQRNSTSNIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQAGSHPGSQSG
SGERFRMRSSSKSEGSPSQRHENTAKKSDEKKEGVRQAKAPGEVDLTALAKELRAVEDVR
PLHKVTDYSSSSEESGTTDEEDDDMEQEGADESTSGPEDARAINGETESVKTMIVHDDAE
SEPAMTPSKEGTLIVRQSTVDKKRAIQLESNGFASRIHLLPDLLQQSHSSSTTSSPTSSQ
PTPTMSPQTPQDKLTANETQSAGNTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVGTY
MRTLESNLKNTNFILVGFSSEALRSEAMRQDPTRKGSVVNVNPTNTRPQSDTPEIRKYKK
RFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTIS
GKKNKLRVYYLSWLRNKILRNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKS
SVEVYAWAPKPYHKFMAFKSFGDLVHRPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGA
VYDIYLPTHIQSSIQPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPT
SVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGS
SQVYFMTLGRSSLLSW
NT seq 4191 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgattcgcctgccaaaagtcttgtggatatagacctgtcctccctgagggac
ccagctggcatctttgaattagtggaagtggtaggaaatggcacctacggacaagtatat
aagggccgacatgtcaaaacaggccaacttgcagccatcaaagtcatggatgttactgag
gatgaagaggaagaaatcaaactggaaatcaatatgctaaagaagtattctcaccacaga
aatatagctacttattatggtgctttcattaaaaaaagtcctccaggccatgatgaccag
ctttggttggtaatggagttctgtggtgctggttcaatcactgacctggtgaagaataca
aaggggaatagtttgaaagaagactggattgcctatatctctcgtgagatacttagggga
ttggcccacctccatgctcatcacgtgattcatcgggatatcaaaggacagaatgtgctg
ctaacagagaatgctgaagtgaaattagtggattttggagttagtgcacagctggacagg
acagtgggccgaaggaacacatttattggcacaccatactggatggctccagaggttatt
gcctgtgatgagaacccagatgctacctatgactacagaagtgacctttggtcatgtggt
attacagcaattgaaatggcagaaggtgctccacctctgtgcgatatgcatccaatgcga
gccctgttccttattccaagaaatcctccacctcggctaaaatccaagaaatggtcaaag
aagttctttaactttatagaaggctgccttgtgaaaaattacacgcagcgtcccccaaca
gaacaactcttaaagcatccatttataagagatcagccaaatgaaaggcaagtcagaatc
cagctgaaagatcacatagacagaacaaggaagaagagaggagagaaagatgaaacggag
tatgaatatagtggaagtgaagaggaggaagaggaagtgcctgaacaggaaggagaacca
agttccattgttaatgtgcctggggaatcgacactccgacgtgatttcctgagactgcag
caggagaacaaggagcgctctgaggccttgcgaaggcaacagctgctgcaggagcaacag
ctcagagaacaggaggaatacaaacgacagctcctggcagagagacagaagcgcatagaa
cagcagaaagagcaaagaaggagacttgaagagcaacaaagaagagaacgtgaggcccgt
cggcagcaggaacgagaacaaagaaggcgagagcaagaggaaaagaagagaatggaggag
atggaaagaagacgtaaggaagaggaagaaaggagaagagcagaggaagagaaaagaaga
gtggaaagagagcaggagtatatccgaagacagctggaggaggagcagcgccacttagaa
atccttcagcagcagctgcttcaggagcaggccatgttactggagtatagatggcgtgag
atggaagagcaccgtcaagcagaaagacttcagcgtcagcttcagcaagaacaggcctat
cttatgtcactacagcatgaccatagaccgcagcagccaccacagcagccccagccccag
cagcctgcactgtcccagcaagaaagaagcaaacaaagttatcatatccaagaaccgaag
cctcatcatgaacaagcagaaagaataagagaggcagaagagcgccttcggaaagcaaac
caaggctcccctgaagcccaggctaagcaaccaggtagagtgttagagccatcagtgcct
tcaagatctgaatcattttccaatggaaattctgagcctgctcagccagccatgcacaga
ccagtggaaccacaggtacagtggtctcatctggcatccctcaagaacaatgtatcccct
gtctcgcgatcccattccttcagtgacccttctcccaaatttgcacctcaccttctacga
tctcaggattcccaccaaacttcacgcagtgaagtgcaaagtcagagttctgaccctaag
tctgaaacctctgagccagcccaaagggtttggactcgatcagacagtgaggaggtgcct
ccaagggtgccggtgaggacaacatcaagatccccagtattgtcacggagagattcacca
ctgcagggcagtgggcagcaaaatacccagactggtcagagaaattccacaagcaatatt
gagcctaggctgctttgggaaagggtagagaagcttgtgccccgacctggtagtggcagc
tcttcaggatcaagtaactctggatcccaagcagggtcccacccaggatctcagagtgga
tctggagagcgcttccgtatgagatcatcttcaaaatctgagggctcaccatcccaacga
catgaaaatacagccaaaaagtctgatgagaagaaagaaggagttagacaggcaaaagct
cctggggaagtggatcttactgcactcgctaaggagcttcgagcagtagaagatgttcga
ccactgcacaaagttaccgactattcttcatccagcgaagagtctggtactacagatgag
gaggatgatgacatggaacaggaaggggcagatgaatcgacttcaggcccagaggatgcc
agagctatcaatggagaaacagagtctgtgaaaacaatgatcgtccatgatgatgctgag
agtgaacccgccatgaccccatctaaagaaggcactttaatcgtccgtcagagtacagtt
gacaaaaagcgtgccatccaacttgagagcaatggctttgccagtcgtattcacctcttg
ccagatctcttacagcaaagccattcctcctccaccacttcttccccaacctcaagtcaa
ccgacacccaccatgtccccccagacaccccaggacaagctaactgctaatgagactcag
tcagctggtaatacccttcagaaacacaaatcttcctcctcattcacaccgttcatagat
ccaaggttacttcagatttctccttctagtgggacaactgtcacgtcagtaggtacatac
atgcgcacactggaatctaaccttaaaaatactaattttattttagtgggattttccagt
gaagcgctaaggtcggaagccatgaggcaagatcctacaagaaaaggatcagttgttaat
gttaatcccacaaatactcggccacaaagtgatacaccggagattcgcaaatacaagaaa
agatttaattctgagattttgtgtgctgcattgtggggtgtaaatttgctggtgggaact
gaaagtggcttaatgttattggatagaagtggccaagggaaagtgtaccctctcattaac
agaaggcgatttcaacagatggatgtgcttgaaggcttaaatgtcttggttactatatca
gggaaaaagaacaagctgcgagtatattacttatcctggctgaggaataaaattttgcgc
aatgaccctgaagtagagaagaagcaaggatggacaactgttggggatttggaaggatgt
gtgcactataaagttgtaaaatacgagcggatcaagtttttggtaattgctttaaaaagt
tcagtggaagtctatgcctgggcaccgaaaccataccacaagtttatggcctttaagtcg
tttggagacttggtgcacagacctctccttgtagacctgactgtagaagaaggacagagg
ctgaaagtgatctatggttcctgcgctggctttcatgctgtagatgtggactcaggcgct
gtctatgatatttacttgccaacccatattcagagcagcattcagccacacgcaatcatc
attctcccaaatactgatggtatggaactgctggtttgctatgaagatgaaggagtttat
gttaatacatatggcaggatcaccaaagatgtagttctacaatggggagaaatgcctaca
tcagttgcttatatccgatccaaccagatcatgggatggggtgaaaaagctattgagatc
cgatcagtggaaactggccaccttgatggagtatttatgcacaaaagggctcaaaggctc
aagttcttgtgtgaacgaaatgacaaggttttctttgcctcagtgcggtctggaggaagc
agtcaagtatatttcatgactttgggcagaagctccctcctgagctggtag

DBGET integrated database retrieval system