KEGG   Xenopus laevis (African clawed frog): 108710334Help
Entry
108710334         CDS       T01010                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    108710334
Membrane trafficking [BR:xla04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    108710334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin ANAPC4_WD40 Vps39_2 zf-RING_2 zf-RING_UBOX TPR_7 zf-RING_11 zf-C3H2C3 PHD
Motif
Other DBs
NCBI-GeneID: 108710334
NCBI-ProteinID: XP_018106962
Position
3L
AA seq 828 aa AA seqDB search
MAQGTLGNVVFRLLLVIWSQFLLKMMAEKQGILEAVGQEEMSQGESTEESEEEESEEEPK
LKYERLLNGVSEILQEDAASCMTVHEKFLALGTHNGKMYLLDIQGNVTQKFDISSVKINQ
ISLDESGEYVGIASEDGKVQVFGLYSREGLHENFDCPIKIVAVHPQFGKSNCKQFVTGGN
KLLLYDRNWLNRWKTSVLHEGEGNITNIKWRGNLIAWANNMGVKILDITTKQRITNIPRG
DTSLRPDMYPCSLFWKDNLTLVIGWGKSVKVCAVKERHATELRDLPSRYVEIVTQFDTDY
YISGIAPLCDQFVMLFFVKETSDKSETMLCARPRLDIIQAHPDSSEEISSDAITVRGFQE
NECRDYRLEYSEGESLFYIISPRDVVVAKERDQDDHIDWLLARKKYEEALMAAEISQKNI
KRHDVLDIGLSYITHLVEKRDYDMAARKCQKILGKNMKLWEDEVYRFKKIGQLKAISKYL
PRGDLRLRPAIYEMILDEFLKTDYEGFSTLIREWPGELYNNKIIVQALKGHLNKDPENRT
LLKALAELHTYDQRYDEALNIYLKLRHKEVFDLIHKHDLFSSIKDKIVLLMDFDTEKAVD
MLLDNEDKISVTEQLTALEICHQRNFVEETVFLLSRMGNSRRALQMIMEELKDVDKAIEF
AKEQDDAELWEDLILYSIDKPPFITGLLNNIGTHVDPILLIHRIKEGMEIPNLRDSLVKI
LQDYNLQILLREGCKKILVSDSLSLLKKLHRTQAKAMLVDDESICEVCLSPLLSTDASKP
LGVVAFHCRHTFHRDCLPVASTMFTLYFCNICCAKNRGPGSAIHEMKK
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagggtacgctgggaaatgtagtttttcggctccttctggtcatatggtcacag
ttcctcctaaaaatgatggctgagaagcagggaattctggaagctgtaggccaggaggaa
atgtcacaaggagaatctacagaagaatctgaggaggaagagagtgaagaggaaccaaag
ttaaaatatgagagactactgaatggtgttagtgaaatccttcaggaagatgctgcaagc
tgtatgactgtgcatgagaagtttctggcactgggaactcacaatgggaagatgtattta
cttgatattcaaggaaatgttacacagaagtttgatataagctctgtgaaaattaatcag
atcagcctggatgaaagtggtgaatatgtgggaattgcctctgaagatggcaaggtgcag
gtgtttggactttactccagagaagggctgcatgaaaatttcgactgcccaattaaaatt
gttgctgttcaccctcagtttggaaaatccaactgtaagcagtttgtaacaggtggaaat
aagctgctgttgtatgataggaattggttaaatcgatggaaaacatctgttttacatgaa
ggggaaggcaacataaccaacataaaatggagagggaatctcattgcttgggccaataat
atgggagtcaaaatattggacataaccacaaagcaaaggattaccaatattcccagaggt
gacacgagccttcgtccagacatgtatccttgtagtctcttctggaaagataacctaacc
cttgtaatcggatggggcaagtctgtcaaggtttgtgctgtaaaagagagacatgccacc
gaattgagggatttgccaagccgatacgttgaaatagttacccagtttgatactgactac
tacataagtggtatagcccctctctgtgaccagtttgtcatgctcttctttgtgaaagaa
acttcagataaatcggagacaatgttgtgtgcgagaccacgtcttgatattattcaggcc
catccagactcaagcgaggagatttcttcagatgccataacagtcagaggcttccaggaa
aatgagtgtcgtgattatcgcttagaatactcagaaggagaatctttattctatataatc
agtccaagagatgttgttgtggcaaaagaacgagaccaagatgaccacattgactggctg
ttggctagaaagaagtatgaggaagctctgatggcagcagaaattagtcagaagaacata
aagagacatgatgtattggatatcggattatcttacataacccatttggtggaaaaaaga
gattatgacatggctgcaagaaaatgtcaaaaaatactgggcaaaaatatgaaactctgg
gaagatgaagtctatcggttcaagaaaatagggcaacttaaggcgataagcaagtatttg
cccaggggagatttacgactgagacctgcaatctatgaaatgatcttggatgaatttttg
aaaacagattatgagggtttctcaacgctaataagagagtggccgggagagctgtacaac
aacaaaataattgttcaagctttaaagggtcacctgaacaaggatccagagaacaggact
ttactgaaggctctagctgaattgcatacttatgaccagcgctatgatgaagcccttaat
atttatctcaaactccggcacaaggaagtatttgatctgatacacaagcacgacctgttt
agctctattaaagacaagattgttcttctcatggactttgatacagagaaagctgttgac
atgctactggacaatgaagataaaatttctgtgacagagcagcttacagcgcttgaaatc
tgccaccagagaaattttgtggaggaaactgtatttcttctaagtagaatgggcaacagc
cggagggctctacaaatgatcatggaagagctgaaagatgtggacaaagccatcgagttt
gctaaggagcaggatgatgcagaattgtgggaggacttaatcttgtattctattgataaa
ccaccatttataactgggttactgaacaacatcgggacccatgtcgacccgatacttctg
attcatcgtataaaagaaggaatggagattcccaatctaagagactcgctcgttaaaatc
ttgcaggattacaacctccagatcttactgagggagggatgcaaaaaaatcctggtgtca
gactctttgtcgttgttaaagaagttgcacagaacccaggccaaagccatgctggtggat
gatgaaagtatttgcgaagtctgcctgtctcccttactttccacagatgcatcgaagcct
ctcggtgtggtggcgttccactgccgacatacatttcacagagactgtttgcctgttgcc
agcactatgtttacgctttatttctgtaacatctgttgtgccaaaaaccgtggacctggg
agtgcaatccatgagatgaagaagtaa

DBGET integrated database retrieval system