KEGG   Xenopus laevis (African clawed frog): 108710975
Entry
108710975         CDS       T01010                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00230  Purine metabolism
xla00240  Pyrimidine metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108710975
   00240 Pyrimidine metabolism
    108710975
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     108710975
SSDB
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33
Other DBs
NCBI-GeneID: 108710975
NCBI-ProteinID: XP_018107725
UniProt: A0A1L8HV98
Position
1L
AA seq 265 aa
MATPPKRICIDVPASPSGNKCKVKRISIEGNIAAGKSTFVNILKKANEEWDVVPEPIARW
CNIQSCKDEFEELTTSQKSGGNLLQMMYEKPERWSFTFQSYACLSRIRAQLKALGGKLKQ
AENPVLFFERSVYSDRYIFASNLYEAECMNETEWTVYQDWHDWMNSQFGADLELDGIIYL
RAIPEKCLNRVYSRGREEEQGIPMEYLEKLHYKHESWLHHRTLRTDFEYLQEIPILTLDV
NEDFKDNKQKQESLIEKVQEFLSTL
NT seq 798 nt   +upstreamnt  +downstreamnt
atggccactccaccgaaaaggatttgcatcgacgtgccagcatccccctcaggcaacaag
tgcaaggtcaagaggatctccatagagggaaacattgctgcagggaaatctacctttgtc
aatattctcaaaaaggccaatgaagagtgggatgttgttcctgagcccatagcaagatgg
tgcaatattcagagctgcaaagatgaatttgaggagctaactacctctcagaaaagtgga
ggtaatctactccagatgatgtatgaaaagccagagcgctggtctttcacttttcagtcc
tatgcttgtctgagtcgtatcagggcccagctgaaagctttgggagggaagctgaaacaa
gcagaaaatccagtgctattctttgaacgctccgtctatagtgacaggtatatctttgca
tccaatttgtatgaggcagagtgcatgaatgaaactgaatggactgtttaccaggattgg
catgattggatgaattctcagttcggtgcagatcttgaactggatggaattatttatctt
cgcgctatccctgagaaatgtttaaacagggtttactcccgtgggcgggaagaagagcaa
ggaattcccatggaatacttggaaaaacttcattacaagcatgagagctggcttcatcac
cgaactctgagaacggattttgagtacctgcaagaaatccccatcctgactttagatgta
aatgaagatttcaaagataataaacagaagcaggagagcctaattgaaaaggttcaagaa
tttctgagcactttataa

DBGET integrated database retrieval system